Recombinant Human BATF Protein, GST-tagged

Cat.No. : BATF-093H
Product Overview : Human BATF partial ORF ( NP_006390, 34 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a nuclear basic leucine zipper protein that belongs to the AP-1/ATF superfamily of transcription factors. The leucine zipper of this protein mediates dimerization with members of the Jun family of proteins. This protein is thought to be a negative regulator of AP-1/ATF transcriptional events.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 35.86 kDa
AA Sequence : EKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQP
Purity : Glutathione Sepharose 4 Fast Flow
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BATF basic leucine zipper transcription factor, ATF-like [ Homo sapiens ]
Official Symbol BATF
Synonyms BATF; basic leucine zipper transcription factor, ATF-like; basic leucine zipper transcriptional factor ATF-like; activating transcription factor B; B ATF; BATF1; SF HT activated gene 2; SFA 2; SF-HT-activated gene 2 protein; B-cell-activating transcription factor; SFA2; B-ATF; SFA-2;
Gene ID 10538
mRNA Refseq NM_006399
Protein Refseq NP_006390
MIM 612476
UniProt ID Q16520

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BATF Products

Required fields are marked with *

My Review for All BATF Products

Required fields are marked with *

0
cart-icon
0
compare icon