Recombinant Human BGN, His-tagged
Cat.No. : | BGN-43H |
Product Overview : | Recombinant Human Biglycan is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Glu20-Lys368) of Human BGN fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 20-368 a.a. |
Description : | Biglycan is a 200-350 kD proteoglycan consisting of a 45 kD core protein and two chrondroitin/dermatan sulfate glycosaminoglycan chains. Biglycan binds to TGF-?. It also binds to collagen type I in low ionic strength (less than 3 mM phosphate) buffer. At higher ionic strengths, Biglycan does not bind to collagen type I. It enhances the inhibition effect of TGF-? on osteoclast proliferation at a concentration of 4-20 mg/ml. It also prevents the attachment of CHO cells to fibronectin, with a 50% inhibition at 17-21 mg/ml. |
Form : | Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
AA Sequence : | EQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSV PKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNH LVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLR ISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTL RELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPY WEVQPATFRCVTDRLAIQFGNYKKVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | BGN biglycan [ Homo sapiens ] |
Official Symbol | BGN |
Synonyms | BGN; biglycan; biglycan proteoglycan; DSPG1; SLRR1A; bone/cartilage proteoglycan I; bone/cartilage proteoglycan-I; small leucine-rich protein 1A; dermatan sulphate proteoglycan I; PGI; PG-S1; |
Gene ID | 633 |
mRNA Refseq | NM_001711 |
Protein Refseq | NP_001702 |
MIM | 301870 |
UniProt ID | P21810 |
Chromosome Location | Xq28 |
Function | extracellular matrix binding; extracellular matrix structural constituent; glycosaminoglycan binding; |
◆ Recombinant Proteins | ||
BGN-635R | Recombinant Rat BGN Protein, His (Fc)-Avi-tagged | +Inquiry |
BGN-1428H | Recombinant Human BGN Protein (Val49-Leu182), N-His tagged | +Inquiry |
BGN-977R | Recombinant Rat BGN Protein | +Inquiry |
BGN-3401H | Recombinant Human BGN protein, His-tagged | +Inquiry |
BGN-1427H | Recombinant Human BGN Protein (Glu20-Lys368), C-His tagged | +Inquiry |
◆ Native Proteins | ||
BGN-13HFL | Active Recombinant Full Length Human BGN Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BGN-1124MCL | Recombinant Mouse BGN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BGN Products
Required fields are marked with *
My Review for All BGN Products
Required fields are marked with *
0
Inquiry Basket