Species : |
Human |
Source : |
HEK293 |
Tag : |
His |
Protein Length : |
20-368 a.a. |
Description : |
Biglycan is a 200-350 kD proteoglycan consisting of a 45 kD core protein and two chrondroitin/dermatan sulfate glycosaminoglycan chains. Biglycan binds to TGF-?. It also binds to collagen type I in low ionic strength (less than 3 mM phosphate) buffer. At higher ionic strengths, Biglycan does not bind to collagen type I. It enhances the inhibition effect of TGF-? on osteoclast proliferation at a concentration of 4-20 mg/ml. It also prevents the attachment of CHO cells to fibronectin, with a 50% inhibition at 17-21 mg/ml. |
Form : |
Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
AA Sequence : |
EQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSV PKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNH LVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLR ISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTL RELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPY WEVQPATFRCVTDRLAIQFGNYKKVDHHHHHH |
Endotoxin : |
Less than 0.1 ng/μg (1 IEU/μg). |
Purity : |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : |
Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at |
Reconstitution : |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |