Recombinant Human BLCAP Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : BLCAP-6097H
Product Overview : BLCAP MS Standard C13 and N15-labeled recombinant protein (NP_006689) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a protein that reduces cell growth by stimulating apoptosis. Alternative splicing and the use of alternative promoters result in multiple transcript variants encoding the same protein. This gene is imprinted in brain where different transcript variants are expressed from each parental allele. Transcript variants initiating from the upstream promoter are expressed preferentially from the maternal allele, while transcript variants initiating downstream of the interspersed NNAT gene (GeneID:4826) are expressed from the paternal allele. Transcripts at this locus may also undergo A to I editing, resulting in amino acid changes at three positions in the N-terminus of the protein.
Molecular Mass : 9.7 kDa
AA Sequence : MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYSCWGNCFLYHCSDSPLPESAHDPGVVGTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name BLCAP bladder cancer associated protein [ Homo sapiens (human) ]
Official Symbol BLCAP
Synonyms Bc10; Bladder cancer 10 kDa protein; Bladder cancer related protein (10kD); Bladder cancer-associated protein; BLCAP; BLCAP_HUMAN; bladder cancer associated protein
Gene ID 10904
mRNA Refseq NM_006698
Protein Refseq NP_006689
MIM 613110
UniProt ID P62952

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BLCAP Products

Required fields are marked with *

My Review for All BLCAP Products

Required fields are marked with *

0
cart-icon
0
compare icon