Recombinant Human BMP2K Protein, GST-tagged

Cat.No. : BMP2K-263H
Product Overview : Human BMP2K partial ORF ( AAH36021, 540 a.a. - 650 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is the human homolog of mouse BMP-2-inducible kinase. Bone morphogenic proteins (BMPs) play a key role in skeletal development and patterning. Expression of the mouse gene is increased during BMP-2 induced differentiation and the gene product is a putative serine/threonine protein kinase containing a nuclear localization signal. Therefore, the protein encoded by this human homolog is thought to be a protein kinase with a putative regulatory role in attenuating the program of osteoblast differentiation. Two transcript variants encoding different isoforms have been found for this gene.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 37.84 kDa
AA Sequence : YQQAFFQQQMLAQHQPSQQQASPEYLTSPQEFSPALVSYTSSLPAQVGTIMDSSYSANRSVADKEAIANFTNQKNISNPPDMSGWNPFGEDNFSKLTEEELLDREFDLLRS
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BMP2K BMP2 inducible kinase [ Homo sapiens ]
Official Symbol BMP2K
Synonyms BMP2K; BMP2 inducible kinase; BMP-2-inducible protein kinase; BIKe; DKFZp434K0614; BIKE; HRIHFB2017; DKFZp434P0116;
Gene ID 55589
mRNA Refseq NM_017593
Protein Refseq NP_060063
UniProt ID Q9NSY1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BMP2K Products

Required fields are marked with *

My Review for All BMP2K Products

Required fields are marked with *

0
cart-icon