Recombinant Human BMP2K Protein, GST-tagged
Cat.No. : | BMP2K-263H |
Product Overview : | Human BMP2K partial ORF ( AAH36021, 540 a.a. - 650 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is the human homolog of mouse BMP-2-inducible kinase. Bone morphogenic proteins (BMPs) play a key role in skeletal development and patterning. Expression of the mouse gene is increased during BMP-2 induced differentiation and the gene product is a putative serine/threonine protein kinase containing a nuclear localization signal. Therefore, the protein encoded by this human homolog is thought to be a protein kinase with a putative regulatory role in attenuating the program of osteoblast differentiation. Two transcript variants encoding different isoforms have been found for this gene. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 37.84 kDa |
AA Sequence : | YQQAFFQQQMLAQHQPSQQQASPEYLTSPQEFSPALVSYTSSLPAQVGTIMDSSYSANRSVADKEAIANFTNQKNISNPPDMSGWNPFGEDNFSKLTEEELLDREFDLLRS |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BMP2K BMP2 inducible kinase [ Homo sapiens ] |
Official Symbol | BMP2K |
Synonyms | BMP2K; BMP2 inducible kinase; BMP-2-inducible protein kinase; BIKe; DKFZp434K0614; BIKE; HRIHFB2017; DKFZp434P0116; |
Gene ID | 55589 |
mRNA Refseq | NM_017593 |
Protein Refseq | NP_060063 |
UniProt ID | Q9NSY1 |
◆ Recombinant Proteins | ||
Bmp2k-1006M | Recombinant Mouse Bmp2k Protein, MYC/DDK-tagged | +Inquiry |
BMP2K-7788Z | Recombinant Zebrafish BMP2K | +Inquiry |
BMP2K-2431M | Recombinant Mouse BMP2K Protein | +Inquiry |
BMP2K-262H | Recombinant Human BMP2K Protein, GST-tagged | +Inquiry |
BMP2K-263H | Recombinant Human BMP2K Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMP2K-8434HCL | Recombinant Human BMP2K 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMP2K Products
Required fields are marked with *
My Review for All BMP2K Products
Required fields are marked with *