Recombinant Human BMP2K Protein, GST-tagged
| Cat.No. : | BMP2K-263H |
| Product Overview : | Human BMP2K partial ORF ( AAH36021, 540 a.a. - 650 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene is the human homolog of mouse BMP-2-inducible kinase. Bone morphogenic proteins (BMPs) play a key role in skeletal development and patterning. Expression of the mouse gene is increased during BMP-2 induced differentiation and the gene product is a putative serine/threonine protein kinase containing a nuclear localization signal. Therefore, the protein encoded by this human homolog is thought to be a protein kinase with a putative regulatory role in attenuating the program of osteoblast differentiation. Two transcript variants encoding different isoforms have been found for this gene. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 37.84 kDa |
| AA Sequence : | YQQAFFQQQMLAQHQPSQQQASPEYLTSPQEFSPALVSYTSSLPAQVGTIMDSSYSANRSVADKEAIANFTNQKNISNPPDMSGWNPFGEDNFSKLTEEELLDREFDLLRS |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BMP2K BMP2 inducible kinase [ Homo sapiens ] |
| Official Symbol | BMP2K |
| Synonyms | BMP2K; BMP2 inducible kinase; BMP-2-inducible protein kinase; BIKe; DKFZp434K0614; BIKE; HRIHFB2017; DKFZp434P0116; |
| Gene ID | 55589 |
| mRNA Refseq | NM_017593 |
| Protein Refseq | NP_060063 |
| UniProt ID | Q9NSY1 |
| ◆ Recombinant Proteins | ||
| BMP2K-2431M | Recombinant Mouse BMP2K Protein | +Inquiry |
| BMP2K-263H | Recombinant Human BMP2K Protein, GST-tagged | +Inquiry |
| BMP2K-1053M | Recombinant Mouse BMP2K Protein, His (Fc)-Avi-tagged | +Inquiry |
| BMP2K-377H | Recombinant Human BMP2K Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| BMP2K-1212H | Recombinant Human BMP2K protein, His&Myc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BMP2K-8434HCL | Recombinant Human BMP2K 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMP2K Products
Required fields are marked with *
My Review for All BMP2K Products
Required fields are marked with *
