Recombinant Human BMX Protein, GST-tagged

Cat.No. : BMX-290H
Product Overview : Human BMX partial ORF ( AAH16652, 150 a.a. - 280 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a non-receptor tyrosine kinase belonging to the Tec kinase family. The protein contains a PH-like domain, which mediates membrane targeting by binding to phosphatidylinositol 3,4,5-triphosphate (PIP3), and a SH2 domain that binds to tyrosine-phosphorylated proteins and functions in signal transduction. The protein is implicated in several signal transduction pathways including the Stat pathway, and regulates differentiation and tumorigenicity of several types of cancer cells. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 40.15 kDa
AA Sequence : ANLHTAVNEEKHRVPTFPDRVLKIPRAVPVLKMDAPSSSTTLAQYDNESKKNYGSQPPSSSTSLAQYDSNSKKIYGSQPNFNMQYIPREDFPDWWQVRKLKSSSSSEDVASSNQKERNVNHTTSKISWEFP
Quality Control Test : 12.5% SDS-PAGE Stained with Coomassie Blue.
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BMX BMX non-receptor tyrosine kinase [ Homo sapiens ]
Official Symbol BMX
Synonyms BMX; BMX non-receptor tyrosine kinase; cytoplasmic tyrosine-protein kinase BMX; ETK; PSCTK3; NTK38 tyrosine kinase; Etk/Bmx cytosolic tyrosine kinase; epithelial and endothelial tyrosine kinase; bone marrow tyrosine kinase gene in chromosome X protein; PSCTK2;
Gene ID 660
mRNA Refseq NM_001721
Protein Refseq NP_001712
MIM 300101
UniProt ID P51813

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BMX Products

Required fields are marked with *

My Review for All BMX Products

Required fields are marked with *

0
cart-icon