Recombinant Human BMX Protein, GST-tagged
Cat.No. : | BMX-290H |
Product Overview : | Human BMX partial ORF ( AAH16652, 150 a.a. - 280 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a non-receptor tyrosine kinase belonging to the Tec kinase family. The protein contains a PH-like domain, which mediates membrane targeting by binding to phosphatidylinositol 3,4,5-triphosphate (PIP3), and a SH2 domain that binds to tyrosine-phosphorylated proteins and functions in signal transduction. The protein is implicated in several signal transduction pathways including the Stat pathway, and regulates differentiation and tumorigenicity of several types of cancer cells. Multiple alternatively spliced variants, encoding the same protein, have been identified. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 40.15 kDa |
AA Sequence : | ANLHTAVNEEKHRVPTFPDRVLKIPRAVPVLKMDAPSSSTTLAQYDNESKKNYGSQPPSSSTSLAQYDSNSKKIYGSQPNFNMQYIPREDFPDWWQVRKLKSSSSSEDVASSNQKERNVNHTTSKISWEFP |
Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BMX BMX non-receptor tyrosine kinase [ Homo sapiens ] |
Official Symbol | BMX |
Synonyms | BMX; BMX non-receptor tyrosine kinase; cytoplasmic tyrosine-protein kinase BMX; ETK; PSCTK3; NTK38 tyrosine kinase; Etk/Bmx cytosolic tyrosine kinase; epithelial and endothelial tyrosine kinase; bone marrow tyrosine kinase gene in chromosome X protein; PSCTK2; |
Gene ID | 660 |
mRNA Refseq | NM_001721 |
Protein Refseq | NP_001712 |
MIM | 300101 |
UniProt ID | P51813 |
◆ Recombinant Proteins | ||
BMX-0752H | Recombinant Human BMX Protein (E411-H675), His tagged | +Inquiry |
BMX-2737HF | Active Recombinant Full Length Human BMX Protein, GST-tagged | +Inquiry |
BMX-251H | Recombinant Human BMX, GST-tagged, Active | +Inquiry |
BMX-10259H | Recombinant Human BMX, His-tagged | +Inquiry |
BMX-290H | Recombinant Human BMX Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMX-8427HCL | Recombinant Human BMX 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMX Products
Required fields are marked with *
My Review for All BMX Products
Required fields are marked with *