Recombinant Human BRPF1 Protein, GST-tagged
Cat.No. : | BRPF1-345H |
Product Overview : | Human BRPF1 partial ORF ( NP_001003694, 500 a.a. - 590 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is expressed ubiquitously and at the highest level in testes and spermatogonia. The protein is localized within nuclei, and it is very similar in structure to two zinc finger proteins, AF10 and AF17. It is suggested that these proteins form a family of regulatory proteins. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 35.75 kDa |
AA Sequence : | ILAEKRAAAPVVSVPCIPPHRLSKITNRLTIQRKSQFMQRLHSYWTLKRQSRNGVPLLRRLQTHLQSQRNCDQVGRDSEDKNWALKEQLKS |
Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BRPF1 bromodomain and PHD finger containing, 1 [ Homo sapiens ] |
Official Symbol | BRPF1 |
Synonyms | BR140 |
Gene ID | 7862 |
mRNA Refseq | NM_001003694 |
Protein Refseq | NP_001003694.1 |
MIM | 602410 |
UniProt ID | P55201 |
◆ Recombinant Proteins | ||
BRPF1-1059H | Recombinant Human BRPF1 Protein (E1079-S1207), His tagged | +Inquiry |
BRPF1-11248Z | Recombinant Zebrafish BRPF1 | +Inquiry |
BRPF1-3111C | Recombinant Chicken BRPF1 | +Inquiry |
BRPF1-1058H | Recombinant Human BRPF1 Protein (E1079-S1207), Tag Free | +Inquiry |
BRPF1-345H | Recombinant Human BRPF1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BRPF1-181HCL | Recombinant Human BRPF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BRPF1 Products
Required fields are marked with *
My Review for All BRPF1 Products
Required fields are marked with *