Recombinant Human CAPZB protein, GST-tagged
| Cat.No. : | CAPZB-2633H |
| Product Overview : | Recombinant Human CAPZB protein(P47756)(1-272aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-272aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 57.6 kDa |
| AA Sequence : | MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | CAPZB capping protein (actin filament) muscle Z-line, beta [ Homo sapiens ] |
| Official Symbol | CAPZB |
| Synonyms | CAPZB; capping protein (actin filament) muscle Z-line, beta; F-actin-capping protein subunit beta; capZ beta; CAPB; CAPZ; CAPPB; FLJ12274; FLJ44693; MGC104401; MGC129749; MGC129750; DKFZp686K0524; |
| Gene ID | 832 |
| mRNA Refseq | NM_001206540 |
| Protein Refseq | NP_001193469 |
| MIM | 601572 |
| UniProt ID | P47756 |
| ◆ Recombinant Proteins | ||
| CAPZB-2854HF | Recombinant Full Length Human CAPZB Protein, GST-tagged | +Inquiry |
| CAPZB-4706H | Recombinant Human CAPZB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CAPZB-0388H | Recombinant Human CAPZB Protein, GST-Tagged | +Inquiry |
| CAPZB-2484H | Recombinant Human CAPZB Protein, MYC/DDK-tagged | +Inquiry |
| CAPZB-794R | Recombinant Rat CAPZB Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CAPZB-281HCL | Recombinant Human CAPZB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CAPZB Products
Required fields are marked with *
My Review for All CAPZB Products
Required fields are marked with *



