Recombinant Human CAPZB protein, GST-tagged

• Cat.No.: CAPZB-2633H
• Product Overview: Recombinant Human CAPZB protein(P47756)(1-272aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-272aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 57.6 kDa
• AA Sequence: MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: CAPZB capping protein (actin filament) muscle Z-line, beta [ Homo sapiens ]
• Official Symbol: CAPZB
• Synonyms: CAPZB; capping protein (actin filament) muscle Z-line, beta; F-actin-capping protein subunit beta; capZ beta; CAPB; CAPZ; CAPPB; FLJ12274; FLJ44693; MGC104401; MGC129749; MGC129750; DKFZp686K0524
• Gene ID: 832
• mRNA Refseq: NM_001206540
• Protein Refseq: NP_001193469
• MIM: 601572
• UniProt ID: P47756