Recombinant Human CCT5 protein, His-tagged
Cat.No. : | CCT5-109H |
Product Overview : | Recombinant Human CCT5 protein (242-541aa) was fused to His-tag and expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 242-541 a.a. |
Description : | The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Mutations in this gene cause hereditary sensory and autonomic neuropathy with spastic paraplegia (HSNSP). Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 5 and 13. |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5% trehalose and 5% mannitol are added as protectants before lyophilization. |
Molecular Mass : | 39 kDa |
AA Sequence : | KVEDAKIAILTCPFEPPKPKTKHKLDVTSVEDYKALQKYEKEKFEEMIQQIKETGANLAICQWGFDDEANHLLLQNNLPAVRWVGGPEIELIAIATGGRIVPRFSELTAEKLGFAGLVQEISFGTTKDKMLVIEQCKNSRAVTIFIRGGNKMIIEEAKRSLHDALCVIRNLIRDNRVVYGGGAAEISCALAVSQEADKCPTLEQYAMRAFADALEVIPMALSENSGMNPIQTMTEVRARQVKEMNPALGIDCLHKGTNDMKQQHVIETLIGKKQQISLATQMVRMILKIDDIRKPGESEE |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8 centigrade for (1-2 weeks). Long-term storage: Aliquot and store at -20 to -80 centigrade for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature. |
Gene Name | CCT5 |
Official Symbol | CCT5 |
Synonyms | CCTE; HEL-S-69; PNAS-102; CCT-epsilon; TCP-1-epsilon |
Gene ID | 22948 |
mRNA Refseq | NM_012073.5 |
Protein Refseq | NP_036205.1 |
MIM | 610150 |
UniProt ID | P48643 |
◆ Recombinant Proteins | ||
CCT5-541R | Recombinant Rhesus Macaque CCT5 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCT5-0714H | Recombinant Human CCT5 Protein, GST-Tagged | +Inquiry |
CCT5-1429M | Recombinant Mouse CCT5 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCT5-529H | Recombinant Human CCT5 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCT5-3043HF | Recombinant Full Length Human CCT5 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCT5-172HCL | Recombinant Human CCT5 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCT5 Products
Required fields are marked with *
My Review for All CCT5 Products
Required fields are marked with *
0
Inquiry Basket