Recombinant Human CD164 Protein, C-His-tagged
Cat.No. : | CD164-152H |
Product Overview : | Recombinant Human CD164 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | CD164 is a mucin-like cell surface glycoprotein that facilitates adhesion of CD34+ cells and serves as a negative regulator of hematopoietic progenitor cell proliferation. Human CD164 in CD34+CD38+ hematopoietic progenitor and epithelial cell lines localizes to endosomes and lysosomes, with low concentrations also appearing at the cell surface. |
Molecular Mass : | ~15 kDa |
AA Sequence : | DKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFD |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | CD164 CD164 molecule, sialomucin [ Homo sapiens (human) ] |
Official Symbol | CD164 |
Synonyms | CD164; CD164 molecule, sialomucin; CD164 antigen, sialomucin; sialomucin core protein 24; MGC 24; MUC 24; MGC-24v; multi-glycosylated core protein 24; MGC-24; MUC-24; endolyn; |
Gene ID | 8763 |
mRNA Refseq | NM_001142401 |
Protein Refseq | NP_001135873 |
MIM | 603356 |
UniProt ID | Q04900 |
◆ Recombinant Proteins | ||
Cd164-7154M | Recombinant Mouse Cd164 protein, His & T7-tagged | +Inquiry |
CD164-152H | Recombinant Human CD164 Protein, C-His-tagged | +Inquiry |
CD164-1590R | Recombinant Rhesus Monkey CD164 Protein | +Inquiry |
CD164-641H | Recombinant Human CD164 | +Inquiry |
CD164-895R | Recombinant Rat CD164 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD164-1257RCL | Recombinant Rat CD164 cell lysate | +Inquiry |
CD164-1932HCL | Recombinant Human CD164 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD164 Products
Required fields are marked with *
My Review for All CD164 Products
Required fields are marked with *