Recombinant Human CD164 Protein, GST-Tagged

Cat.No. : CD164-0728H
Product Overview : Human CD164 full-length ORF (AAH11522.1, 1 a.a. - 197 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a transmembrane sialomucin and cell adhesion molecule that regulates the proliferation, adhesion and migration of hematopoietic progenitor cells. The encoded protein also interacts with the C-X-C chemokine receptor type 4 and may regulate muscle development. Elevated expression of this gene has been observed in human patients with Sez
Molecular Mass : 47.41 kDa
AA Sequence : MSRLSRSLLWAATCLGVLCVLSADKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFDAASFIGGIVLVLGVQAVIFFLYKFCKSKERNYHTL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CD164 CD164 molecule, sialomucin [ Homo sapiens ]
Official Symbol CD164
Synonyms CD164; CD164 molecule, sialomucin; CD164 antigen, sialomucin; sialomucin core protein 24; MGC 24; MUC 24; MGC-24v; multi-glycosylated core protein 24; MGC-24; MUC-24; endolyn;
Gene ID 8763
mRNA Refseq NM_001142401
Protein Refseq NP_001135873
MIM 603356
UniProt ID Q04900

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD164 Products

Required fields are marked with *

My Review for All CD164 Products

Required fields are marked with *

0
cart-icon