Recombinant Human CD164 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CD164-5140H |
Product Overview : | CD164 MS Standard C13 and N15-labeled recombinant protein (NP_006007) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a transmembrane sialomucin and cell adhesion molecule that regulates the proliferation, adhesion and migration of hematopoietic progenitor cells. The encoded protein also interacts with the C-X-C chemokine receptor type 4 and may regulate muscle development. Elevated expression of this gene has been observed in human patients with Sezary syndrome, a type of blood cancer, and a mutation in this gene may be associated with impaired hearing. |
Molecular Mass : | 20.9 kDa |
AA Sequence : | MSRLSRSLLWAATCLGVLCVLSADKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFDAASFIGGIVLVLGVQAVIFFLYKFCKSKERNYHTLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CD164 CD164 molecule [ Homo sapiens (human) ] |
Official Symbol | CD164 |
Synonyms | CD164; CD164 molecule, sialomucin; CD164 antigen, sialomucin; sialomucin core protein 24; MGC 24; MUC 24; MGC-24v; multi-glycosylated core protein 24; MGC-24; MUC-24; endolyn; |
Gene ID | 8763 |
mRNA Refseq | NM_006016 |
Protein Refseq | NP_006007 |
MIM | 603356 |
UniProt ID | Q04900 |
◆ Recombinant Proteins | ||
CD164-895R | Recombinant Rat CD164 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD164-1592R | Recombinant Rhesus Monkey CD164 Protein, hIgG4-tagged | +Inquiry |
Cd164-3522M | Recombinant Mouse Cd164 protein, hFc-tagged | +Inquiry |
CD164-5764H | Recombinant Human CD164 protein, hFc-tagged | +Inquiry |
CD164-2988HF | Recombinant Full Length Human CD164 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD164-1257RCL | Recombinant Rat CD164 cell lysate | +Inquiry |
CD164-1932HCL | Recombinant Human CD164 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD164 Products
Required fields are marked with *
My Review for All CD164 Products
Required fields are marked with *