"CD5L" Related Products

Expand
Expand

Recombinant Human CD5L protein, T7/His-tagged

Cat.No.: CD5L-74H
Product Overview: Recombinant human CD5L cDNA (20 – 347 aa, derived from BC033586) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFSPSGVRLVGGLHRCEGRVEVEQKGQWGTVCDDGWDIKDVAVLCREL GCGAASGTPSGILYEPPAEKEQKVLIQSVSCTGTEDTLAQCEQEEVYDCSHDEDAGASCENPESSFSPVPEGVRL ADGPGHCKGRVEVKHQNQWYTVCQTGWSLRAAKVVCRQLGCGRAVLTQKRCNKHAYGRKPIWLSQMSCSGREATL QDCPSGPWGKNTCNHDEDTWVECEDPFDLRLVGGDNLCSGRLEVLHKGVWGSVCDDNWGEKEDQVVCKQLGCGKS LSPSFRDRKCYGPGVGRIWLDNVRCSGEEQSLEQCQHRFWGFHDCTHQEDVAVICSG
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro non-glycosylated CD5L protein mediated lipolytic pathway regulation study with this protein as either coating matrix protein or as soluble factor.2. May be used for CD5L protein – protein interaction assay.3. May be used as enzymatic substrate for various proteases.4. Potential diagnostic and therapeutic target protein for controlling obesity disease.5. May be used for specific antibody production.
Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name: CD5L CD5 molecule-like [ Homo sapiens ]
Official Symbol: CD5L
Synonyms: CD5L; CD5 molecule-like; API6, apoptosis inhibitor 6 , CD5 antigen like (scavenger receptor cysteine rich family); CD5 antigen-like; Spalpha; CT-2; apoptosis inhibitor 6; igM-associated peptide; CD5 antigen-like (scavenger receptor cysteine rich family)
Gene ID: 922
mRNA Refseq: NM_005894
Protein Refseq: NP_005885
MIM: 602592
UniProt ID: O43866
Chromosome Location: 1q21-q23
Function: scavenger receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.