Recombinant Human CD5L protein, T7/His-tagged
| Cat.No. : | CD5L-74H |
| Product Overview : | Recombinant human CD5L cDNA (20 – 347 aa, derived from BC033586) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Protein Length : | 20-347 a.a. |
| Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFSPSGVRLVGGLHRCEGRVEVEQKGQWGTVCDDGWDIKDVAVLCREL GCGAASGTPSGILYEPPAEKEQKVLIQSVSCTGTEDTLAQCEQEEVYDCSHDEDAGASCENPESSFSPVPEGVRL ADGPGHCKGRVEVKHQNQWYTVCQTGWSLRAAKVVCRQLGCGRAVLTQKRCNKHAYGRKPIWLSQMSCSGREATL QDCPSGPWGKNTCNHDEDTWVECEDPFDLRLVGGDNLCSGRLEVLHKGVWGSVCDDNWGEKEDQVVCKQLGCGKS LSPSFRDRKCYGPGVGRIWLDNVRCSGEEQSLEQCQHRFWGFHDCTHQEDVAVICSG |
| Purity : | >90% by SDS-PAGE |
| Applications : | 1. May be used for in vitro non-glycosylated CD5L protein mediated lipolytic pathway regulation study with this protein as either coating matrix protein or as soluble factor.2. May be used for CD5L protein – protein interaction assay.3. May be used as enzymatic substrate for various proteases.4. Potential diagnostic and therapeutic target protein for controlling obesity disease.5. May be used for specific antibody production. |
| Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
| Gene Name | CD5L CD5 molecule-like [ Homo sapiens ] |
| Official Symbol | CD5L |
| Synonyms | CD5L; CD5 molecule-like; API6, apoptosis inhibitor 6 , CD5 antigen like (scavenger receptor cysteine rich family); CD5 antigen-like; Spalpha; CT-2; apoptosis inhibitor 6; igM-associated peptide; CD5 antigen-like (scavenger receptor cysteine rich family) |
| Gene ID | 922 |
| mRNA Refseq | NM_005894 |
| Protein Refseq | NP_005885 |
| MIM | 602592 |
| UniProt ID | O43866 |
| Chromosome Location | 1q21-q23 |
| Function | scavenger receptor activity; |
| ◆ Recombinant Proteins | ||
| Cd5l-629M | Recombinant Mouse Cd5l Protein, MYC/DDK-tagged | +Inquiry |
| CD5L-27580TH | Recombinant Human CD5L | +Inquiry |
| CD5L-10965H | Recombinant Full Length Human CD5L, His-tagged | +Inquiry |
| CD5L-3061H | Recombinant Human CD5L Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CD5L-0837H | Recombinant Human CD5L Protein, GST-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD5L-3042MCL | Recombinant Mouse CD5L cell lysate | +Inquiry |
| CD5L-2302HCL | Recombinant Human CD5L cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD5L Products
Required fields are marked with *
My Review for All CD5L Products
Required fields are marked with *
