Recombinant Human CDC14A protein, His-tagged
Cat.No. : | CDC14A-3828H |
Product Overview : | Recombinant Human CDC14A protein(1-191 aa), fused to His tag, was expressed in E. coli. |
Availability | August 06, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-191 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MAAESGELIGACEFMKDRLYFATLRNRPKSTVNTHYFSIDEELVYENFYADFGPLNLAMVYRYCCKLNKKLKSYSLSRKKIVHYTCFDQRKRANAAFLIGAYAVIYLKKTPEEAYRALLSGSNPPYLPFRDASFGNCTYNLTILDCLQGIRKGLQHGFFDFETFDVDEYEHYEVILFTPLKPTFLISKSIM |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CDC14A CDC14 cell division cycle 14 homolog A (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | CDC14A |
Synonyms | CDC14A; CDC14 cell division cycle 14 homolog A (S. cerevisiae); CDC10 (cell division cycle 10, S. cerevisiae, homolog); dual specificity protein phosphatase CDC14A; cdc14; Cdc14A1; Cdc14A2; hCDC14; |
Gene ID | 8556 |
mRNA Refseq | NM_003672 |
Protein Refseq | NP_003663 |
MIM | 603504 |
UniProt ID | Q9UNH5 |
◆ Recombinant Proteins | ||
CDC14A-3828H | Recombinant Human CDC14A protein, His-tagged | +Inquiry |
CDC14A-4089C | Recombinant Chicken CDC14A | +Inquiry |
CDC14A-0898H | Recombinant Human CDC14A Protein, GST-Tagged | +Inquiry |
Cdc14a-714M | Recombinant Mouse Cdc14a Protein, His-tagged | +Inquiry |
CDC14A-3114HF | Recombinant Full Length Human CDC14A Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDC14A Products
Required fields are marked with *
My Review for All CDC14A Products
Required fields are marked with *