Recombinant Human CELA3B protein, GST-tagged

Cat.No. : CELA3B-256H
Product Overview : Recombinant Human CELA3B(19 a.a. - 270 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 19-270 a.a.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 53.46 kDa
AA Sequence : GPPSSRPSSRVVNGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISSSWTYQVVLGEYDRAVK EGPEQVIPINSGDLFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNETPCYITGWGRLYTN GPLPDKLQEALLPVVDYEHCSRWNWWGSSVKKTMVCAGGDIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFG CNTRRKPTVFTRVSAFIDWIEETIASH
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name CELA3B chymotrypsin-like elastase family, member 3B [ Homo sapiens ]
Official Symbol CELA3B
Synonyms CELA3B; chymotrypsin-like elastase family, member 3B; ELA3B, elastase 3B, pancreatic; chymotrypsin-like elastase family member 3B; CBPP; cholesterol binding pancreatic protease; elastase 1; pancreatic endopeptidase E; proteinase E; protease E; elastase-3B; elastase IIIB; fecal elastase 1; pancreatic elastase 1; elastase 3B, pancreatic; cholesterol-binding pancreatic protease; E1; EL-1; ELA3B;
Gene ID 23436
mRNA Refseq NM_007352
Protein Refseq NP_031378
MIM
UniProt ID P08861
Chromosome Location 1p36.12
Pathway Pancreatic secretion, organism-specific biosystem; Pancreatic secretion, conserved biosystem; Protein digestion and absorption, organism-specific biosystem; Protein digestion and absorption, conserved biosystem;
Function peptidase activity; serine-type endopeptidase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CELA3B Products

Required fields are marked with *

My Review for All CELA3B Products

Required fields are marked with *

0
cart-icon