Recombinant Human CELA3B protein, GST-tagged
Cat.No. : | CELA3B-256H |
Product Overview : | Recombinant Human CELA3B(19 a.a. - 270 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 19-270 a.a. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 53.46 kDa |
AA Sequence : | GPPSSRPSSRVVNGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISSSWTYQVVLGEYDRAVK EGPEQVIPINSGDLFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNETPCYITGWGRLYTN GPLPDKLQEALLPVVDYEHCSRWNWWGSSVKKTMVCAGGDIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFG CNTRRKPTVFTRVSAFIDWIEETIASH |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | CELA3B chymotrypsin-like elastase family, member 3B [ Homo sapiens ] |
Official Symbol | CELA3B |
Synonyms | CELA3B; chymotrypsin-like elastase family, member 3B; ELA3B, elastase 3B, pancreatic; chymotrypsin-like elastase family member 3B; CBPP; cholesterol binding pancreatic protease; elastase 1; pancreatic endopeptidase E; proteinase E; protease E; elastase-3B; elastase IIIB; fecal elastase 1; pancreatic elastase 1; elastase 3B, pancreatic; cholesterol-binding pancreatic protease; E1; EL-1; ELA3B; |
Gene ID | 23436 |
mRNA Refseq | NM_007352 |
Protein Refseq | NP_031378 |
MIM | |
UniProt ID | P08861 |
Chromosome Location | 1p36.12 |
Pathway | Pancreatic secretion, organism-specific biosystem; Pancreatic secretion, conserved biosystem; Protein digestion and absorption, organism-specific biosystem; Protein digestion and absorption, conserved biosystem; |
Function | peptidase activity; serine-type endopeptidase activity; |
◆ Recombinant Proteins | ||
CELA3B-1566M | Recombinant Mouse CELA3B Protein, His (Fc)-Avi-tagged | +Inquiry |
CELA3B-65H | Recombinant Human CELA3B, His-tagged | +Inquiry |
CELA3B-3470H | Recombinant Human CELA3B Protein (Val31-His270), His tagged | +Inquiry |
Cela3b-1164R | Recombinant Rat Cela3b protein, His-tagged | +Inquiry |
CELA3B-1163H | Recombinant Human CELA3B protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CELA3B-25P | Native Porcine Elastase Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CELA3B-7591HCL | Recombinant Human CELA3B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CELA3B Products
Required fields are marked with *
My Review for All CELA3B Products
Required fields are marked with *