"CELA3B" Related Products

Expand

Recombinant Human CELA3B protein, GST-tagged

Cat.No.: CELA3B-256H
Product Overview: Recombinant Human CELA3B(19 a.a. - 270 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 53.46 kDa
AA Sequence: GPPSSRPSSRVVNGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISSSWTYQVVLGEYDRAVK EGPEQVIPINSGDLFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNETPCYITGWGRLYTN GPLPDKLQEALLPVVDYEHCSRWNWWGSSVKKTMVCAGGDIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFG CNTRRKPTVFTRVSAFIDWIEETIASH
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: CELA3B chymotrypsin-like elastase family, member 3B [ Homo sapiens ]
Official Symbol: CELA3B
Synonyms: CELA3B; chymotrypsin-like elastase family, member 3B; ELA3B, elastase 3B, pancreatic; chymotrypsin-like elastase family member 3B; CBPP; cholesterol binding pancreatic protease; elastase 1; pancreatic endopeptidase E; proteinase E; protease E; elastase-3B; elastase IIIB; fecal elastase 1; pancreatic elastase 1; elastase 3B, pancreatic; cholesterol-binding pancreatic protease; E1; EL-1; ELA3B;
Gene ID: 23436
mRNA Refseq: NM_007352
Protein Refseq: NP_031378
MIM:
UniProt ID: P08861
Chromosome Location: 1p36.12
Pathway: Pancreatic secretion, organism-specific biosystem; Pancreatic secretion, conserved biosystem; Protein digestion and absorption, organism-specific biosystem; Protein digestion and absorption, conserved biosystem;
Function: peptidase activity; serine-type endopeptidase activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.