Recombinant Human CFDP1 Protein (1-299 aa), GST-tagged
Cat.No. : | CFDP1-2128H |
Product Overview : | Recombinant Human CFDP1 Protein (1-299 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Stem Cells. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-299 aa |
Description : | May play a role during embryogenesis. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 60.6 kDa |
AA Sequence : | MEEFDSEDFSTSEEDEDYVPSGGEYSEDDVNELVKEDEVDGEEQTQKTQGKKRKAQSIPARKRRQGGLSLEEEEEEDANSESEGSSSEEEDDAAEQEKGIGSEDARKKKEDELWASFLNDVGPKSKVPPSTQVKKGEETEETSSSKLLVKAEELEKPKETEKVKITKVFDFAGEEVRVTKEVDATSKEAKSFFKQNEKEKPQANVPSALPSLPAGSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESFKEEEGIGEELAIHNRGKEGYIERKAFLDRVDHRQFEIERDLRLSKMKP |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | CFDP1 craniofacial development protein 1 [ Homo sapiens ] |
Official Symbol | CFDP1 |
Synonyms | CFDP1; BCNT; Bucentaur; CENP 29; CP27; p97; SWC5; Yeti; CENP-29; BUCENTAUR; |
Gene ID | 10428 |
mRNA Refseq | NM_006324 |
Protein Refseq | NP_006315 |
MIM | 608108 |
UniProt ID | Q9UEE9 |
◆ Recombinant Proteins | ||
CFDP1-5834Z | Recombinant Zebrafish CFDP1 | +Inquiry |
CFDP1-1611M | Recombinant Mouse CFDP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CFDP1-1012R | Recombinant Rat CFDP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CFDP1-827R | Recombinant Rhesus monkey CFDP1 Protein, His-tagged | +Inquiry |
CFDP1-1071C | Recombinant Chicken CFDP1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CFDP1-7557HCL | Recombinant Human CFDP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CFDP1 Products
Required fields are marked with *
My Review for All CFDP1 Products
Required fields are marked with *
0
Inquiry Basket