Recombinant Human CFDP1 Protein (1-299 aa), GST-tagged

• Cat.No.: CFDP1-2128H
• Product Overview: Recombinant Human CFDP1 Protein (1-299 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Stem Cells. Protein Description: Full Length.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-299 aa
• Description: May play a role during embryogenesis.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 60.6 kDa
• AA Sequence: MEEFDSEDFSTSEEDEDYVPSGGEYSEDDVNELVKEDEVDGEEQTQKTQGKKRKAQSIPARKRRQGGLSLEEEEEEDANSESEGSSSEEEDDAAEQEKGIGSEDARKKKEDELWASFLNDVGPKSKVPPSTQVKKGEETEETSSSKLLVKAEELEKPKETEKVKITKVFDFAGEEVRVTKEVDATSKEAKSFFKQNEKEKPQANVPSALPSLPAGSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESFKEEEGIGEELAIHNRGKEGYIERKAFLDRVDHRQFEIERDLRLSKMKP
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: CFDP1 craniofacial development protein 1 [ Homo sapiens ]
• Official Symbol: CFDP1
• Synonyms: CFDP1; BCNT; Bucentaur; CENP 29; CP27; p97; SWC5; Yeti; CENP-29; BUCENTAUR
• Gene ID: 10428
• mRNA Refseq: NM_006324
• Protein Refseq: NP_006315
• MIM: 608108
• UniProt ID: Q9UEE9