Recombinant Human CFDP1 protein, His-tagged
| Cat.No. : | CFDP1-3789H |
| Product Overview : | Recombinant Human CFDP1 protein(172-299 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | February 03, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 172-299 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
| AASequence : | AGEEVRVTKEVDATSKEAKSFFKQNEKEKPQANVPSALPSLPAGSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESFKEEEGIGEELAIHNRGKEGYIERKAFLDRVDHRQFEIERDLRLSKMKP |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | CFDP1 craniofacial development protein 1 [ Homo sapiens ] |
| Official Symbol | CFDP1 |
| Synonyms | CFDP1; craniofacial development protein 1; BCNT; Bucentaur; CENP 29; centromere protein 29; CP27; p97; SWC5; Yeti; phosphoprotein (Bucentaur); CENP-29; BUCENTAUR; |
| Gene ID | 10428 |
| mRNA Refseq | NM_006324 |
| Protein Refseq | NP_006315 |
| MIM | 608108 |
| UniProt ID | Q9UEE9 |
| ◆ Recombinant Proteins | ||
| CFDP1-827R | Recombinant Rhesus monkey CFDP1 Protein, His-tagged | +Inquiry |
| CFDP1-301301H | Recombinant Human CFDP1 protein, GST-tagged | +Inquiry |
| CFDP1-1611M | Recombinant Mouse CFDP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CFDP1-1071C | Recombinant Chicken CFDP1 | +Inquiry |
| CFDP1-5834Z | Recombinant Zebrafish CFDP1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CFDP1-7557HCL | Recombinant Human CFDP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CFDP1 Products
Required fields are marked with *
My Review for All CFDP1 Products
Required fields are marked with *
