Recombinant Human CFDP1 protein, His-tagged

• Cat.No.: CFDP1-3789H
• Product Overview: Recombinant Human CFDP1 protein(172-299 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 172-299 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
• AASequence: AGEEVRVTKEVDATSKEAKSFFKQNEKEKPQANVPSALPSLPAGSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESFKEEEGIGEELAIHNRGKEGYIERKAFLDRVDHRQFEIERDLRLSKMKP
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: CFDP1 craniofacial development protein 1 [ Homo sapiens ]
• Official Symbol: CFDP1
• Synonyms: CFDP1; craniofacial development protein 1; BCNT; Bucentaur; CENP 29; centromere protein 29; CP27; p97; SWC5; Yeti; phosphoprotein (Bucentaur); CENP-29; BUCENTAUR
• Gene ID: 10428
• mRNA Refseq: NM_006324
• Protein Refseq: NP_006315
• MIM: 608108
• UniProt ID: Q9UEE9