Recombinant Human CFL1

• Cat.No.: CFL1-26778TH
• Product Overview: Recombinant full length Human Cofilin with 25 kDa proprietary tag produced in Saccharomyces cerevisiae; amino acids 1-166; 166 amino acids, MWt 18.5kDa.

Specification

• Species: Human
• Tag: Non
• Protein Length: 1-166 a.a.
• Description: The protein encoded by this gene can polymerize and depolymerize F-actin and G-actin in a pH-dependent manner. Increased phosphorylation of this protein by LIM kinase aids in Rho-induced reorganization of the actin cytoskeleton. Cofilin is a widely distributed intracellular actin-modulating protein that binds and depolymerizes filamentous F-actin and inhibits the polymerization of monomeric G-actin in a pH-dependent manner. It is involved in the translocation of actin-cofilin complex from cytoplasm to nucleus.
• Tissue specificity: Widely distributed in various tissues.
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
• Sequences of amino acids: MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCL SEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDK DCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGS AVISLEGKPL
• Sequence Similarities: Belongs to the actin-binding proteins ADF family.Contains 1 ADF-H domain.
• Full Length: Full L.

Gene Information

• Gene Name: CFL1 cofilin 1 (non-muscle) [ Homo sapiens ]
• Official Symbol: CFL1
• Synonyms: CFL1; cofilin 1 (non-muscle); CFL; cofilin-1
• Gene ID: 1072
• mRNA Refseq: NM_005507
• Protein Refseq: NP_005498
• MIM: 601442
• Uniprot ID: P23528
• Chromosome Location: 11q13.1
• Pathway: Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; Axon guidance, organism-specific biosystem; CDC42 signaling events, organism-specific biosystem; CXCR4-mediated signaling events, organism-specific biosystem
• Function: actin binding; protein binding