Recombinant Human CFL1

Cat.No. : CFL1-26778TH
Product Overview : Recombinant full length Human Cofilin with 25 kDa proprietary tag produced in Saccharomyces cerevisiae; amino acids 1-166; 166 amino acids, MWt 18.5kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Tag : Non
Protein Length : 1-166 a.a.
Description : The protein encoded by this gene can polymerize and depolymerize F-actin and G-actin in a pH-dependent manner. Increased phosphorylation of this protein by LIM kinase aids in Rho-induced reorganization of the actin cytoskeleton. Cofilin is a widely distributed intracellular actin-modulating protein that binds and depolymerizes filamentous F-actin and inhibits the polymerization of monomeric G-actin in a pH-dependent manner. It is involved in the translocation of actin-cofilin complex from cytoplasm to nucleus.
Tissue specificity : Widely distributed in various tissues.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids : MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCL SEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDK DCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGS AVISLEGKPL
Sequence Similarities : Belongs to the actin-binding proteins ADF family.Contains 1 ADF-H domain.
Full Length : Full L.
Gene Name CFL1 cofilin 1 (non-muscle) [ Homo sapiens ]
Official Symbol CFL1
Synonyms CFL1; cofilin 1 (non-muscle); CFL; cofilin-1;
Gene ID 1072
mRNA Refseq NM_005507
Protein Refseq NP_005498
MIM 601442
Uniprot ID P23528
Chromosome Location 11q13.1
Pathway Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; Axon guidance, organism-specific biosystem; CDC42 signaling events, organism-specific biosystem; CXCR4-mediated signaling events, organism-specific biosystem;
Function actin binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CFL1 Products

Required fields are marked with *

My Review for All CFL1 Products

Required fields are marked with *

0
cart-icon
0
compare icon