Recombinant Human CHAC2 Protein, GST-Tagged

Cat.No. : CHAC2-1200H
Product Overview : Human CHAC2 full-length ORF (NP_001008708.1, 1 a.a. - 184 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a gamma-glutamyl cyclotransferase that catalyzes the conversion of glutathione to 5-oxoproline and cysteinylglycine. It is thought that this gene is upregulated in response to endoplasmic reticulum stress and that the glutathione depletion enhances apoptosis. [provided by RefSeq, Sep 2016]
Molecular Mass : 47.3 kDa
AA Sequence : MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVVTLVEDPAGCVWGVAYRLPVGKEEEVKAYLDFREKGGYRTTTVIFYPKDPTTKPFSVLLYIGTCDNPDYLGPAPLEDIAEQIFNAAGPSGRNTEYLFELANSIRNLVPEEADEHLFALEKLVKERLEGKQNLNCI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CHAC2 ChaC, cation transport regulator homolog 2 (E. coli) [ Homo sapiens (human) ]
Official Symbol CHAC2
Synonyms Cation transport regulator like protein 2; Cation transport regulator-like protein 2; ChaC, cation transport regulator homolog 2 (E. coli); chac2; CHAC2_HUMAN;
Gene ID 494143
mRNA Refseq NM_001008708
Protein Refseq NP_001008708
MIM 617446
UniProt ID Q8WUX2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHAC2 Products

Required fields are marked with *

My Review for All CHAC2 Products

Required fields are marked with *

0
cart-icon
0
compare icon