Recombinant Human CHAC2 Protein, GST-Tagged
| Cat.No. : | CHAC2-1200H |
| Product Overview : | Human CHAC2 full-length ORF (NP_001008708.1, 1 a.a. - 184 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is a gamma-glutamyl cyclotransferase that catalyzes the conversion of glutathione to 5-oxoproline and cysteinylglycine. It is thought that this gene is upregulated in response to endoplasmic reticulum stress and that the glutathione depletion enhances apoptosis. [provided by RefSeq, Sep 2016] |
| Molecular Mass : | 47.3 kDa |
| AA Sequence : | MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVVTLVEDPAGCVWGVAYRLPVGKEEEVKAYLDFREKGGYRTTTVIFYPKDPTTKPFSVLLYIGTCDNPDYLGPAPLEDIAEQIFNAAGPSGRNTEYLFELANSIRNLVPEEADEHLFALEKLVKERLEGKQNLNCI |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CHAC2 ChaC, cation transport regulator homolog 2 (E. coli) [ Homo sapiens (human) ] |
| Official Symbol | CHAC2 |
| Synonyms | Cation transport regulator like protein 2; Cation transport regulator-like protein 2; ChaC, cation transport regulator homolog 2 (E. coli); chac2; CHAC2_HUMAN; |
| Gene ID | 494143 |
| mRNA Refseq | NM_001008708 |
| Protein Refseq | NP_001008708 |
| MIM | 617446 |
| UniProt ID | Q8WUX2 |
| ◆ Recombinant Proteins | ||
| CHAC2-1402H | Recombinant Human CHAC2 | +Inquiry |
| CHAC2-835R | Recombinant Rhesus monkey CHAC2 Protein, His-tagged | +Inquiry |
| CHAC2-661R | Recombinant Rhesus Macaque CHAC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CHAC2-2712C | Recombinant Chicken CHAC2 | +Inquiry |
| CHAC2-415H | Recombinant Human ChaC, cation transport regulator homolog 2 (E. coli), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CHAC2-344HCL | Recombinant Human CHAC2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHAC2 Products
Required fields are marked with *
My Review for All CHAC2 Products
Required fields are marked with *
