Recombinant Human CHAC2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CHAC2-2028H
Product Overview : CHAC2 MS Standard C13 and N15-labeled recombinant protein (NP_001008708) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is a gamma-glutamyl cyclotransferase that catalyzes the conversion of glutathione to 5-oxoproline and cysteinylglycine. It is thought that this gene is upregulated in response to endoplasmic reticulum stress and that the glutathione depletion enhances apoptosis.
Molecular Mass : 20.9 kDa
AA Sequence : MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVVTLVEDPAGCVWGVAYRLPVGKEEEVKAYLDFREKGGYRTTTVIFYPKDPTTKPFSVLLYIGTCDNPDYLGPAPLEDIAEQIFNAAGPSGRNTEYLFELANSIRNLVPEEADEHLFALEKLVKERLEGKQNLNCITRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CHAC2 ChaC glutathione specific gamma-glutamylcyclotransferase 2 [ Homo sapiens (human) ]
Official Symbol CHAC2
Synonyms Cation transport regulator like protein 2; Cation transport regulator-like protein 2; ChaC, cation transport regulator homolog 2 (E. coli); chac2; CHAC2_HUMAN;
Gene ID 494143
mRNA Refseq NM_001008708
Protein Refseq NP_001008708
MIM 617446
UniProt ID Q8WUX2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHAC2 Products

Required fields are marked with *

My Review for All CHAC2 Products

Required fields are marked with *

0
cart-icon
0
compare icon