Recombinant Human CHAC2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CHAC2-2028H |
Product Overview : | CHAC2 MS Standard C13 and N15-labeled recombinant protein (NP_001008708) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a gamma-glutamyl cyclotransferase that catalyzes the conversion of glutathione to 5-oxoproline and cysteinylglycine. It is thought that this gene is upregulated in response to endoplasmic reticulum stress and that the glutathione depletion enhances apoptosis. |
Molecular Mass : | 20.9 kDa |
AA Sequence : | MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVVTLVEDPAGCVWGVAYRLPVGKEEEVKAYLDFREKGGYRTTTVIFYPKDPTTKPFSVLLYIGTCDNPDYLGPAPLEDIAEQIFNAAGPSGRNTEYLFELANSIRNLVPEEADEHLFALEKLVKERLEGKQNLNCITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CHAC2 ChaC glutathione specific gamma-glutamylcyclotransferase 2 [ Homo sapiens (human) ] |
Official Symbol | CHAC2 |
Synonyms | Cation transport regulator like protein 2; Cation transport regulator-like protein 2; ChaC, cation transport regulator homolog 2 (E. coli); chac2; CHAC2_HUMAN; |
Gene ID | 494143 |
mRNA Refseq | NM_001008708 |
Protein Refseq | NP_001008708 |
MIM | 617446 |
UniProt ID | Q8WUX2 |
◆ Recombinant Proteins | ||
CHAC2-2028H | Recombinant Human CHAC2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CHAC2-415H | Recombinant Human ChaC, cation transport regulator homolog 2 (E. coli), His-tagged | +Inquiry |
CHAC2-590H | Recombinant Human CHAC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHAC2-661R | Recombinant Rhesus Macaque CHAC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Chac2-2135M | Recombinant Mouse Chac2 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHAC2-344HCL | Recombinant Human CHAC2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHAC2 Products
Required fields are marked with *
My Review for All CHAC2 Products
Required fields are marked with *