Recombinant Human CHAC2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CHAC2-2028H
• Product Overview: CHAC2 MS Standard C13 and N15-labeled recombinant protein (NP_001008708) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene is a gamma-glutamyl cyclotransferase that catalyzes the conversion of glutathione to 5-oxoproline and cysteinylglycine. It is thought that this gene is upregulated in response to endoplasmic reticulum stress and that the glutathione depletion enhances apoptosis.
• Molecular Mass: 20.9 kDa
• AA Sequence: MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVVTLVEDPAGCVWGVAYRLPVGKEEEVKAYLDFREKGGYRTTTVIFYPKDPTTKPFSVLLYIGTCDNPDYLGPAPLEDIAEQIFNAAGPSGRNTEYLFELANSIRNLVPEEADEHLFALEKLVKERLEGKQNLNCITRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CHAC2 ChaC glutathione specific gamma-glutamylcyclotransferase 2 [ Homo sapiens (human) ]
• Official Symbol: CHAC2
• Synonyms: Cation transport regulator like protein 2; Cation transport regulator-like protein 2; ChaC, cation transport regulator homolog 2 (E. coli); chac2; CHAC2_HUMAN
• Gene ID: 494143
• mRNA Refseq: NM_001008708
• Protein Refseq: NP_001008708
• MIM: 617446
• UniProt ID: Q8WUX2