Recombinant Human CHIA protein, His-tagged
Cat.No. : | CHIA-4633H |
Product Overview : | Recombinant Human CHIA protein(1-368 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-368 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNIKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPAQPIEPITAAPSGSGNGSGSSSSGGSSGGSGFCAVRANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNWA |
Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | CHIA chitinase, acidic [ Homo sapiens ] |
Official Symbol | CHIA |
Synonyms | CHIA; chitinase, acidic; acidic mammalian chitinase; AMCase; CHIT2; TSA1902; lung-specific protein TSA1902; AMCASE; DKFZp313J1722; |
Gene ID | 27159 |
mRNA Refseq | NM_001040623 |
Protein Refseq | NP_001035713 |
MIM | 606080 |
UniProt ID | Q9BZP6 |
◆ Recombinant Proteins | ||
CHIA-154H | Recombinant Human CHIA Protein, His-tagged | +Inquiry |
CHIA-406C | Recombinant Cynomolgus CHIA Protein, His-tagged | +Inquiry |
CHIA-4633H | Recombinant Human CHIA protein, His-tagged | +Inquiry |
CHIA-1371R | Recombinant Rat CHIA Protein | +Inquiry |
CHIA-1029R | Recombinant Rat CHIA Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHIA-7539HCL | Recombinant Human CHIA 293 Cell Lysate | +Inquiry |
CHIA-7538HCL | Recombinant Human CHIA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHIA Products
Required fields are marked with *
My Review for All CHIA Products
Required fields are marked with *
0
Inquiry Basket