Recombinant Human CHMP4C protein, His-tagged

• Cat.No.: CHMP4C-11188H
• Product Overview: Recombinant Human CHMP4C protein(1-233 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-233 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
• AASequence: MSKLGKFFKGGGSSKSRAAPSPQEALVRLRETEEMLGKKQEYLENRIQREIALAKKHGTQNKRAALQALKRKKRFEKQLTQIDGTLSTIEFQREALENSHTNTEVLRNMGFAAKAMKSVHENMDLNKIDDLMQEITEQQDIAQEISEAFSQRVGFGDDFDEDELMAELEELEQEELNKKMTNIRLPNVPSSSLPAQPNRKPGMSSTARRSRAASSQRAEEEDDDIKQLAAWAT
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: CHMP4C charged multivesicular body protein 4C [ Homo sapiens ]
• Official Symbol: CHMP4C
• Synonyms: Charged multivesicular body protein 4c; CHM4C_HUMAN; CHMP4c; Chromatin-modifying protein 4c; hSnf7-3; hVps32-3; SNF7 homolog associated with Alix 3; SNF7-3; Vacuolar protein sorting-associated protein 32-3; Vps32-3
• Gene ID: 92421
• mRNA Refseq: NM_152284.3
• Protein Refseq: NP_689497.1
• MIM: 610899
• UniProt ID: Q96CF2