Recombinant Human CHMP4C protein, His-tagged
Cat.No. : | CHMP4C-11188H |
Product Overview : | Recombinant Human CHMP4C protein(1-233 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | October 11, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-233 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MSKLGKFFKGGGSSKSRAAPSPQEALVRLRETEEMLGKKQEYLENRIQREIALAKKHGTQNKRAALQALKRKKRFEKQLTQIDGTLSTIEFQREALENSHTNTEVLRNMGFAAKAMKSVHENMDLNKIDDLMQEITEQQDIAQEISEAFSQRVGFGDDFDEDELMAELEELEQEELNKKMTNIRLPNVPSSSLPAQPNRKPGMSSTARRSRAASSQRAEEEDDDIKQLAAWAT |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | CHMP4C charged multivesicular body protein 4C [ Homo sapiens ] |
Official Symbol | CHMP4C |
Synonyms | Charged multivesicular body protein 4c; CHM4C_HUMAN; CHMP4c; Chromatin-modifying protein 4c; hSnf7-3; hVps32-3; SNF7 homolog associated with Alix 3; SNF7-3; Vacuolar protein sorting-associated protein 32-3; Vps32-3; |
Gene ID | 92421 |
mRNA Refseq | NM_152284.3 |
Protein Refseq | NP_689497.1 |
MIM | 610899 |
UniProt ID | Q96CF2 |
◆ Recombinant Proteins | ||
CHMP4C-1711HFL | Recombinant Full Length Human CHMP4C Protein, C-Flag-tagged | +Inquiry |
CHMP4C-602H | Recombinant Human CHMP4C Protein, His (Fc)-Avi-tagged | +Inquiry |
CHMP4C-851R | Recombinant Rhesus monkey CHMP4C Protein, His-tagged | +Inquiry |
CHMP4C-677R | Recombinant Rhesus Macaque CHMP4C Protein, His (Fc)-Avi-tagged | +Inquiry |
CHMP4C-1654M | Recombinant Mouse CHMP4C Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHMP4C-7531HCL | Recombinant Human CHMP4C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHMP4C Products
Required fields are marked with *
My Review for All CHMP4C Products
Required fields are marked with *