Recombinant Human CHST10 Protein, His-tagged
Cat.No. : | CHST10-968H |
Product Overview : | Recombinant human CHST10 (28-356aa) fused to His-tag at N-terminus, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 28-356 |
Description : | This protein encoded by this gene transfers sulfate to the C-3 hydroxyl of terminal glucuronic acid of protein- and lipid-linked oligosaccharides. This protein was first identified as a sulfotransferase that acts on the human natural killer-1 (HNK-1) glycan; HNK-1 is a carbohydrate involved in neurodevelopment and synaptic plasticity. |
Molecular Mass : | 41.2 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMTFKDPDVYSAKQEFLFLTTMPEVRKLPEEKHIPEELKPTGKELPDSQLVQPLVYMERLELIRNVCRDDALKNLSHTPVSKFVLDRIFVCDKHKILFCQTPKVGNTQWKKVLIVLNGAFSSIEEIPENVVHDHEKNGLPRLSSFSDAEIQKRLKTYFKFFIVRDPFERLISAFKDKFVHNPRFEPWYRHEIAPGIIRKYRRNRTETRGIQFEDFVRYLGDPNHRWLDLQFGDHIIHWVTYVELCAPCEIMYSVIGHHETLEDDAPYILKEAGIDHLVSYPTIPPGITVYNRTKVEHYFLGISKRDIRRLYARFEGDFKLFGYQKPDFLLN |
Purity : | >85% by SDS - PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
Storage Buffer : | 20mM Tris-HCl (pH8.0) containing 10% glycerol. |
Gene Name | CHST10 carbohydrate sulfotransferase 10 [ Homo sapiens (human) ] |
Official Symbol | CHST10 |
Synonyms | CHST10; carbohydrate sulfotransferase 10; HNK1ST; HNK-1ST; carbohydrate sulfotransferase 10; HNK-1 sulfotransferase; huHNK-1ST; EC 2.8.2.- |
Gene ID | 9486 |
mRNA Refseq | NM_004854 |
Protein Refseq | NP_004845 |
MIM | 606376 |
UniProt ID | O43529 |
◆ Recombinant Proteins | ||
CHST10-692R | Recombinant Rhesus Macaque CHST10 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL21200HF | Recombinant Full Length Human Carbohydrate Sulfotransferase 10(Chst10) Protein, His-Tagged | +Inquiry |
CHST10-1404R | Recombinant Rat CHST10 Protein | +Inquiry |
CHST10-969H | Active Recombinant Human CHST10 Protein, His-tagged | +Inquiry |
CHST10-1112Z | Recombinant Zebrafish CHST10 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHST10-7508HCL | Recombinant Human CHST10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHST10 Products
Required fields are marked with *
My Review for All CHST10 Products
Required fields are marked with *