Recombinant Human CHST10 Protein, His-tagged
| Cat.No. : | CHST10-968H | 
| Product Overview : | Recombinant human CHST10 (28-356aa) fused to His-tag at N-terminus, was expressed in E.coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 28-356 | 
| Description : | This protein encoded by this gene transfers sulfate to the C-3 hydroxyl of terminal glucuronic acid of protein- and lipid-linked oligosaccharides. This protein was first identified as a sulfotransferase that acts on the human natural killer-1 (HNK-1) glycan; HNK-1 is a carbohydrate involved in neurodevelopment and synaptic plasticity. | 
| Molecular Mass : | 41.2 kDa | 
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMTFKDPDVYSAKQEFLFLTTMPEVRKLPEEKHIPEELKPTGKELPDSQLVQPLVYMERLELIRNVCRDDALKNLSHTPVSKFVLDRIFVCDKHKILFCQTPKVGNTQWKKVLIVLNGAFSSIEEIPENVVHDHEKNGLPRLSSFSDAEIQKRLKTYFKFFIVRDPFERLISAFKDKFVHNPRFEPWYRHEIAPGIIRKYRRNRTETRGIQFEDFVRYLGDPNHRWLDLQFGDHIIHWVTYVELCAPCEIMYSVIGHHETLEDDAPYILKEAGIDHLVSYPTIPPGITVYNRTKVEHYFLGISKRDIRRLYARFEGDFKLFGYQKPDFLLN | 
| Purity : | >85% by SDS - PAGE | 
| Stability : | Shelf life: one year from despatch. | 
| Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. | 
| Storage Buffer : | 20mM Tris-HCl (pH8.0) containing 10% glycerol. | 
| Gene Name | CHST10 carbohydrate sulfotransferase 10 [ Homo sapiens (human) ] | 
| Official Symbol | CHST10 | 
| Synonyms | CHST10; carbohydrate sulfotransferase 10; HNK1ST; HNK-1ST; carbohydrate sulfotransferase 10; HNK-1 sulfotransferase; huHNK-1ST; EC 2.8.2.- | 
| Gene ID | 9486 | 
| mRNA Refseq | NM_004854 | 
| Protein Refseq | NP_004845 | 
| MIM | 606376 | 
| UniProt ID | O43529 | 
| ◆ Recombinant Proteins | ||
| CHST10-969H | Active Recombinant Human CHST10 Protein, His-tagged | +Inquiry | 
| CHST10-1062R | Recombinant Rat CHST10 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| CHST10-866R | Recombinant Rhesus monkey CHST10 Protein, His-tagged | +Inquiry | 
| Chst10-001M | Recombinant Mouse Chst10 Protein, Myc/DDK-tagged | +Inquiry | 
| CHST10-2229C | Recombinant Chicken CHST10 | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CHST10-7508HCL | Recombinant Human CHST10 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHST10 Products
Required fields are marked with *
My Review for All CHST10 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            