Recombinant Human CHST10 Protein, His-tagged

Cat.No. : CHST10-968H
Product Overview : Recombinant human CHST10 (28-356aa) fused to His-tag at N-terminus, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 28-356
Description : This protein encoded by this gene transfers sulfate to the C-3 hydroxyl of terminal glucuronic acid of protein- and lipid-linked oligosaccharides. This protein was first identified as a sulfotransferase that acts on the human natural killer-1 (HNK-1) glycan; HNK-1 is a carbohydrate involved in neurodevelopment and synaptic plasticity.
Molecular Mass : 41.2 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMTFKDPDVYSAKQEFLFLTTMPEVRKLPEEKHIPEELKPTGKELPDSQLVQPLVYMERLELIRNVCRDDALKNLSHTPVSKFVLDRIFVCDKHKILFCQTPKVGNTQWKKVLIVLNGAFSSIEEIPENVVHDHEKNGLPRLSSFSDAEIQKRLKTYFKFFIVRDPFERLISAFKDKFVHNPRFEPWYRHEIAPGIIRKYRRNRTETRGIQFEDFVRYLGDPNHRWLDLQFGDHIIHWVTYVELCAPCEIMYSVIGHHETLEDDAPYILKEAGIDHLVSYPTIPPGITVYNRTKVEHYFLGISKRDIRRLYARFEGDFKLFGYQKPDFLLN
Purity : >85% by SDS - PAGE
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer.
Avoid repeated freezing and thawing.
Storage Buffer : 20mM Tris-HCl (pH8.0) containing 10% glycerol.
Gene Name CHST10 carbohydrate sulfotransferase 10 [ Homo sapiens (human) ]
Official Symbol CHST10
Synonyms CHST10; carbohydrate sulfotransferase 10; HNK1ST; HNK-1ST; carbohydrate sulfotransferase 10; HNK-1 sulfotransferase; huHNK-1ST; EC 2.8.2.-
Gene ID 9486
mRNA Refseq NM_004854
Protein Refseq NP_004845
MIM 606376
UniProt ID O43529

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHST10 Products

Required fields are marked with *

My Review for All CHST10 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon