Recombinant Human CHST10 Protein, His-tagged

• Cat.No.: CHST10-968H
• Product Overview: Recombinant human CHST10 (28-356aa) fused to His-tag at N-terminus, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 28-356
• Description: This protein encoded by this gene transfers sulfate to the C-3 hydroxyl of terminal glucuronic acid of protein- and lipid-linked oligosaccharides. This protein was first identified as a sulfotransferase that acts on the human natural killer-1 (HNK-1) glycan; HNK-1 is a carbohydrate involved in neurodevelopment and synaptic plasticity.
• Molecular Mass: 41.2 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMTFKDPDVYSAKQEFLFLTTMPEVRKLPEEKHIPEELKPTGKELPDSQLVQPLVYMERLELIRNVCRDDALKNLSHTPVSKFVLDRIFVCDKHKILFCQTPKVGNTQWKKVLIVLNGAFSSIEEIPENVVHDHEKNGLPRLSSFSDAEIQKRLKTYFKFFIVRDPFERLISAFKDKFVHNPRFEPWYRHEIAPGIIRKYRRNRTETRGIQFEDFVRYLGDPNHRWLDLQFGDHIIHWVTYVELCAPCEIMYSVIGHHETLEDDAPYILKEAGIDHLVSYPTIPPGITVYNRTKVEHYFLGISKRDIRRLYARFEGDFKLFGYQKPDFLLN
• Purity: >85% by SDS - PAGE
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer.
  Avoid repeated freezing and thawing.
• Storage Buffer: 20mM Tris-HCl (pH8.0) containing 10% glycerol.

Gene Information

• Gene Name: CHST10 carbohydrate sulfotransferase 10 [ Homo sapiens (human) ]
• Official Symbol: CHST10
• Synonyms: CHST10; carbohydrate sulfotransferase 10; HNK1ST; HNK-1ST; carbohydrate sulfotransferase 10; HNK-1 sulfotransferase; huHNK-1ST; EC 2.8.2.-
• Gene ID: 9486
• mRNA Refseq: NM_004854
• Protein Refseq: NP_004845
• MIM: 606376
• UniProt ID: O43529