Recombinant Human CHTF8 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CHTF8-3727H
Product Overview : CHTF8 MS Standard C13 and N15-labeled recombinant protein (NP_001035236) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a short protein that forms part of the Ctf18 replication factor C (RFC) complex that occurs in both yeast and mammals. The heteroheptameric RFC complex plays a role in sister chromatid cohesion and may load the replication clamp PCNA (proliferating cell nuclear antigen) onto DNA during DNA replication and repair. This gene is ubiquitously expressed and has been shown to have reduced expression in renal and prostate tumors. Alternatively spliced transcript variants have been described. This gene has a pseudogene on chromosome X.
Molecular Mass : 13.3 kDa
AA Sequence : MVQIVISSARAGGLAEWVLMELQGEIEARYSTGLAGNLLGDLHYTTEGIPVLIVGHHILYGKIIHLEKPFAVLVKHTPGDQDCDELGRETGTRYLVTALIKDKILFKTRPKPIITSVPKKVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CHTF8 chromosome transmission fidelity factor 8 [ Homo sapiens (human) ]
Official Symbol CHTF8
Synonyms CHTF8; chromosome transmission fidelity factor 8; CTF8; DERPC; chromosome transmission fidelity protein 8 homolog; CTF8, chromosome transmission fidelity factor 8 homolog; decreased expression in renal and prostate cancer protein
Gene ID 54921
mRNA Refseq NM_001040146
Protein Refseq NP_001035236
MIM 613202
UniProt ID P0CG13

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHTF8 Products

Required fields are marked with *

My Review for All CHTF8 Products

Required fields are marked with *

0
cart-icon
0
compare icon