Recombinant Human COASY protein, T7-tagged
Cat.No. : | COASY-137H |
Product Overview : | Recombinant human COASY (269aa, Isoform_b) fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 269 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGEFMAINRFRLENDLEELALYQIQLLKDLRHTENEEDKVSSSSFRQRMLGNLLRPPYERPELP TCLYVIGLTGISGSGKSSIAQRLKGLGAFVIDSDHLGHRAYAPGGPAYQPVVEAFGTDILHKDGIINRKVLGSRV FGNKKQLKILTDIMWPIIAKLAREEMDRAVAEGKRVCVIDAAVLLEAGWQNLVHEVWTAVIPETEAVRRIVERDG LSEAAAQSRLQSQMSGQQLVEQSHVVLSTLWEPHITQRQVEKAWALLQKRIPKTHQALD |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | COASY CoA synthase [ Homo sapiens ] |
Official Symbol | COASY |
Synonyms | COASY; CoA synthase; Coenzyme A synthase; bifunctional coenzyme A synthase; CoASY; DPCK; NBP; PPAT; nucleotide binding protein; phosphopantetheine adenylyltransferase / dephosphocoenzyme A kinase; bifunctional phosphopantetheine adenylyl transferase/dephospho CoA kinase; UKR1; pOV-2; FLJ35179; |
Gene ID | 80347 |
mRNA Refseq | NM_001042529 |
Protein Refseq | NP_001035994 |
MIM | 609855 |
UniProt ID | Q13057 |
Chromosome Location | 17q12-q21 |
Pathway | Coenzyme A biosynthesis, organism-specific biosystem; Coenzyme A biosynthesis, pantothenate =>CoA, organism-specific biosystem; Coenzyme A biosynthesis, pantothenate => CoA, conserved biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; |
Function | ATP binding; dephospho-CoA kinase activity; nucleotide binding; nucleotidyltransferase activity; pantetheine-phosphate adenylyltransferase activity; transferase activity; |
◆ Recombinant Proteins | ||
Coasy-2234M | Recombinant Mouse Coasy Protein, Myc/DDK-tagged | +Inquiry |
COASY-4006H | Recombinant Human COASY Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
COASY-1293H | Recombinant Human COASY Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
COASY-11415H | Recombinant Human COASY, GST-tagged | +Inquiry |
COASY-3655H | Recombinant Human COASY protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COASY-7387HCL | Recombinant Human COASY 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COASY Products
Required fields are marked with *
My Review for All COASY Products
Required fields are marked with *