Recombinant Human COASY protein, T7-tagged

• Cat.No.: COASY-137H
• Product Overview: Recombinant human COASY (269aa, Isoform_b) fused with T7 Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: T7
• Protein Length: 269 a.a.
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MASMTGGQQMGRGEFMAINRFRLENDLEELALYQIQLLKDLRHTENEEDKVSSSSFRQRMLGNLLRPPYERPELP TCLYVIGLTGISGSGKSSIAQRLKGLGAFVIDSDHLGHRAYAPGGPAYQPVVEAFGTDILHKDGIINRKVLGSRV FGNKKQLKILTDIMWPIIAKLAREEMDRAVAEGKRVCVIDAAVLLEAGWQNLVHEVWTAVIPETEAVRRIVERDG LSEAAAQSRLQSQMSGQQLVEQSHVVLSTLWEPHITQRQVEKAWALLQKRIPKTHQALD
• Purity: >90% by SDS-PAGE
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.

Gene Information

• Gene Name: COASY CoA synthase [ Homo sapiens ]
• Official Symbol: COASY
• Synonyms: COASY; CoA synthase; Coenzyme A synthase; bifunctional coenzyme A synthase; CoASY; DPCK; NBP; PPAT; nucleotide binding protein; phosphopantetheine adenylyltransferase / dephosphocoenzyme A kinase; bifunctional phosphopantetheine adenylyl transferase/dephospho CoA kinase; UKR1; pOV-2; FLJ35179
• Gene ID: 80347
• mRNA Refseq: NM_001042529
• Protein Refseq: NP_001035994
• MIM: 609855
• UniProt ID: Q13057
• Chromosome Location: 17q12-q21
• Pathway: Coenzyme A biosynthesis, organism-specific biosystem; Coenzyme A biosynthesis, pantothenate =>CoA, organism-specific biosystem; Coenzyme A biosynthesis, pantothenate => CoA, conserved biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem
• Function: ATP binding; dephospho-CoA kinase activity; nucleotide binding; nucleotidyltransferase activity; pantetheine-phosphate adenylyltransferase activity; transferase activity