Recombinant Human COMMD2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | COMMD2-5269H |
Product Overview : | COMMD2 MS Standard C13 and N15-labeled recombinant protein (NP_057178) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | COMMD2 (COMM Domain Containing 2) is a Protein Coding gene. |
Molecular Mass : | 22.7 kDa |
AA Sequence : | MLLELSEEHKEHLAFLPQVDSAVVAEFGRIAVEFLRRGANPKIYEGAARKLNVSSDTVQHGVEGLTYLLTESSKLMISELDFQDSVFVLGFSEELNKLLLQLYLDNRKEIRTLLSELAPSLPSYHNLEWRLDVQLASRSLRQQIKPAVTIKLHLNQNGDHNTKVLQTDPATLLHLVQQLEQALEEMKTNHCRRVVRNIKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | COMMD2 COMM domain containing 2 [ Homo sapiens (human) ] |
Official Symbol | COMMD2 |
Synonyms | COMMD2; COMM domain containing 2; COMM domain-containing protein 2; HSPC042; MGC57611; |
Gene ID | 51122 |
mRNA Refseq | NM_016094 |
Protein Refseq | NP_057178 |
MIM | 616699 |
UniProt ID | Q86X83 |
◆ Recombinant Proteins | ||
COMMD2-1677H | Recombinant Human COMMD2 Protein, GST-tagged | +Inquiry |
Commd2-2248M | Recombinant Mouse Commd2 Protein, Myc/DDK-tagged | +Inquiry |
COMMD2-2217HF | Recombinant Full Length Human COMMD2 Protein, GST-tagged | +Inquiry |
COMMD2-962R | Recombinant Rhesus monkey COMMD2 Protein, His-tagged | +Inquiry |
COMMD2-5269H | Recombinant Human COMMD2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
COMMD2-7371HCL | Recombinant Human COMMD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COMMD2 Products
Required fields are marked with *
My Review for All COMMD2 Products
Required fields are marked with *