Recombinant Human COMMD2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : COMMD2-5269H
Product Overview : COMMD2 MS Standard C13 and N15-labeled recombinant protein (NP_057178) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : COMMD2 (COMM Domain Containing 2) is a Protein Coding gene.
Molecular Mass : 22.7 kDa
AA Sequence : MLLELSEEHKEHLAFLPQVDSAVVAEFGRIAVEFLRRGANPKIYEGAARKLNVSSDTVQHGVEGLTYLLTESSKLMISELDFQDSVFVLGFSEELNKLLLQLYLDNRKEIRTLLSELAPSLPSYHNLEWRLDVQLASRSLRQQIKPAVTIKLHLNQNGDHNTKVLQTDPATLLHLVQQLEQALEEMKTNHCRRVVRNIKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name COMMD2 COMM domain containing 2 [ Homo sapiens (human) ]
Official Symbol COMMD2
Synonyms COMMD2; COMM domain containing 2; COMM domain-containing protein 2; HSPC042; MGC57611;
Gene ID 51122
mRNA Refseq NM_016094
Protein Refseq NP_057178
MIM 616699
UniProt ID Q86X83

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COMMD2 Products

Required fields are marked with *

My Review for All COMMD2 Products

Required fields are marked with *

0
cart-icon