Recombinant Human COMMD2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: COMMD2-5269H
• Product Overview: COMMD2 MS Standard C13 and N15-labeled recombinant protein (NP_057178) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: COMMD2 (COMM Domain Containing 2) is a Protein Coding gene.
• Molecular Mass: 22.7 kDa
• AA Sequence: MLLELSEEHKEHLAFLPQVDSAVVAEFGRIAVEFLRRGANPKIYEGAARKLNVSSDTVQHGVEGLTYLLTESSKLMISELDFQDSVFVLGFSEELNKLLLQLYLDNRKEIRTLLSELAPSLPSYHNLEWRLDVQLASRSLRQQIKPAVTIKLHLNQNGDHNTKVLQTDPATLLHLVQQLEQALEEMKTNHCRRVVRNIKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: COMMD2 COMM domain containing 2 [ Homo sapiens (human) ]
• Official Symbol: COMMD2
• Synonyms: COMMD2; COMM domain containing 2; COMM domain-containing protein 2; HSPC042; MGC57611
• Gene ID: 51122
• mRNA Refseq: NM_016094
• Protein Refseq: NP_057178
• MIM: 616699
• UniProt ID: Q86X83