Recombinant Human COMMD8 Protein, GST-tagged
| Cat.No. : | COMMD8-1685H |
| Product Overview : | Human COMMD8 full-length ORF ( NP_060315.1, 1 a.a. - 183 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene binds coiled-coil domain-containing protein 22 (CCDC22), and this complex can regulate the turnover of I-kappa-B and the activation of NF-kappa-B. [provided by RefSeq, Jul 2016] |
| Molecular Mass : | 47.5 kDa |
| AA Sequence : | MEPEEGTPLWRLQKLPAELGPQLLHKIIDGICGRAYPVYQDYHTVWESEEWMHVLEDIAKFFKAIVGKNLPDEEIFQQLNQLNSLHQETIMKCVKSRKDEIKQALSREIVAISSAQLQDFDWQVKLALSSDKIAALRMPLLSLHLDVKENGEVKPYSIEMSREELQNLIQSLEAANKVVLQLK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | COMMD8 COMM domain containing 8 [ Homo sapiens ] |
| Official Symbol | COMMD8 |
| Synonyms | COMMD8; COMM domain containing 8; COMM domain-containing protein 8; FLJ20502; |
| Gene ID | 54951 |
| mRNA Refseq | NM_017845 |
| Protein Refseq | NP_060315 |
| MIM | 616656 |
| UniProt ID | Q9NX08 |
| ◆ Recombinant Proteins | ||
| COMMD8-3951H | Recombinant Human COMMD8 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| COMMD8-1945HF | Recombinant Full Length Human COMMD8 Protein, GST-tagged | +Inquiry |
| COMMD8-1685H | Recombinant Human COMMD8 Protein, GST-tagged | +Inquiry |
| COMMD8-791R | Recombinant Rhesus Macaque COMMD8 Protein, His (Fc)-Avi-tagged | +Inquiry |
| COMMD8-5173C | Recombinant Chicken COMMD8 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| COMMD8-7367HCL | Recombinant Human COMMD8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COMMD8 Products
Required fields are marked with *
My Review for All COMMD8 Products
Required fields are marked with *
