Recombinant Human COMMD8 Protein, GST-tagged
Cat.No. : | COMMD8-1685H |
Product Overview : | Human COMMD8 full-length ORF ( NP_060315.1, 1 a.a. - 183 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene binds coiled-coil domain-containing protein 22 (CCDC22), and this complex can regulate the turnover of I-kappa-B and the activation of NF-kappa-B. [provided by RefSeq, Jul 2016] |
Molecular Mass : | 47.5 kDa |
AA Sequence : | MEPEEGTPLWRLQKLPAELGPQLLHKIIDGICGRAYPVYQDYHTVWESEEWMHVLEDIAKFFKAIVGKNLPDEEIFQQLNQLNSLHQETIMKCVKSRKDEIKQALSREIVAISSAQLQDFDWQVKLALSSDKIAALRMPLLSLHLDVKENGEVKPYSIEMSREELQNLIQSLEAANKVVLQLK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COMMD8 COMM domain containing 8 [ Homo sapiens ] |
Official Symbol | COMMD8 |
Synonyms | COMMD8; COMM domain containing 8; COMM domain-containing protein 8; FLJ20502; |
Gene ID | 54951 |
mRNA Refseq | NM_017845 |
Protein Refseq | NP_060315 |
MIM | 616656 |
UniProt ID | Q9NX08 |
◆ Recombinant Proteins | ||
Commd8-2253M | Recombinant Mouse Commd8 Protein, Myc/DDK-tagged | +Inquiry |
COMMD8-1945HF | Recombinant Full Length Human COMMD8 Protein, GST-tagged | +Inquiry |
COMMD8-3951H | Recombinant Human COMMD8 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
COMMD8-791R | Recombinant Rhesus Macaque COMMD8 Protein, His (Fc)-Avi-tagged | +Inquiry |
COMMD8-360H | Recombinant Human COMMD8 protein(Met1-Lys183), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COMMD8-7367HCL | Recombinant Human COMMD8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COMMD8 Products
Required fields are marked with *
My Review for All COMMD8 Products
Required fields are marked with *