Recombinant Human COQ7 Protein, GST-tagged

Cat.No. : COQ7-1720H
Product Overview : Human COQ7 full-length ORF ( NP_057222.2, 1 a.a. - 217 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is similar to a mitochondrial di-iron containing hydroxylase in Saccharomyces cerevisiae that is involved with ubiquinone biosynthesis. Mutations in the yeast gene lead to slower development and longer life span. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2010]
Molecular Mass : 50.7 kDa
AA Sequence : MSCAGAAAAPRLWRLRPGARRSLSAYGRRTSVRFRSSGMTLDNISRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVLGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELEHHDIGLDHDAELAPAYAVLKSIIQAGCRVAIYLSERL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name COQ7 coenzyme Q7 homolog, ubiquinone (yeast) [ Homo sapiens ]
Official Symbol COQ7
Synonyms COQ7; coenzyme Q7 homolog, ubiquinone (yeast); coenzyme Q, 7 (rat, yeast) homolog; ubiquinone biosynthesis protein COQ7 homolog; CAT5; CLK 1; placental protein KG-20; timing protein clk-1 homolog; COQ7 coenzyme Q, 7 homolog ubiquinone; coenzyme Q biosynthesis protein 7 homolog; CLK1; CLK-1;
Gene ID 10229
mRNA Refseq NM_001190983
Protein Refseq NP_001177912
MIM 601683
UniProt ID Q99807

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COQ7 Products

Required fields are marked with *

My Review for All COQ7 Products

Required fields are marked with *

0
cart-icon
0
compare icon