Recombinant Human CRYBA1 Protein, GST-tagged
| Cat.No. : | CRYBA1-1927H |
| Product Overview : | Human CRYBA1 full-length ORF ( NP_005199.2, 1 a.a. - 215 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and then retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families; beta and gamma crystallins are also considered as a superfamily. Alpha and beta families are further divided into acidic and basic groups. Seven protein regions exist in crystallins: four homologous motifs, a connecting peptide, and N- and C-terminal extensions. Beta-crystallins, the most heterogeneous, differ by the presence of the C-terminal extension (present in the basic group, none in the acidic group). Beta-crystallins form aggregates of different sizes and are able to self-associate to form dimers or to form heterodimers with other beta-crystallins. This gene, a beta acidic group member, encodes two proteins (crystallin, beta A3 and crystallin, beta A1) from a single mRNA, the latter protein is 17 aa shorter than crystallin, beta A3 and is generated by use of an alternate translation initiation site. Deletion of exons 3 and 4 causes the autosomal dominant disease 'zonular cataract with sutural opacities'. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 51.5 kDa |
| AA Sequence : | METQAEQQELETLPTTKMAQTNPTPGSLGPWKITIYDQENFQGKRMEFTSSCPNVSERSFDNVRSLKVESGAWIGYEHTSFCGQQFILERGEYPRWDAWSGSNAYHIERLMSFRPICSANHKESKMTIFEKENFIGRQWEISDDYPSLQAMGWFNNEVGSMKIQSGAWVCYQYPGYRGYQYILECDHHGGDYKHWREWGSHAQTSQIQSIRRIQQ |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CRYBA1 crystallin, beta A1 [ Homo sapiens ] |
| Official Symbol | CRYBA1 |
| Synonyms | CRYBA1; crystallin, beta A1; CRYB1; beta-crystallin A3; eye lens structural protein; crystallin, beta A3; |
| Gene ID | 1411 |
| mRNA Refseq | NM_005208 |
| Protein Refseq | NP_005199 |
| MIM | 123610 |
| UniProt ID | P05813 |
| ◆ Recombinant Proteins | ||
| CRYBA1-1269R | Recombinant Rat CRYBA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CRYBA1-1038R | Recombinant Rhesus monkey CRYBA1 Protein, His-tagged | +Inquiry |
| CRYBA1-863R | Recombinant Rhesus Macaque CRYBA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CRYBA1-7051C | Recombinant Chicken CRYBA1 | +Inquiry |
| CRYBA1-2129HF | Recombinant Full Length Human CRYBA1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CRYBA1-7265HCL | Recombinant Human CRYBA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRYBA1 Products
Required fields are marked with *
My Review for All CRYBA1 Products
Required fields are marked with *
