Recombinant Human CRYBB1 protein, His-tagged
Cat.No. : | CRYBB1-11601H |
Product Overview : | Recombinant Human CRYBB1 protein(1-252 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | August 24, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-252 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MSQAAKASASATVAVNPGPDTKGKGAPPAGTSPSPGTTLAPTTVPITSAKAAELPPGNYRLVVFELENFQGRRAEFSGECSNLADRGFDRVRSIIVSAGPWVAFEQSNFRGEMFILEKGEYPRWNTWSSSYRSDRLMSFRPIKMDAQEHKISLFEGANFKGNTIEIQGDDAPSLWVYGFSDRVGSVKVSSGTWVGYQYPGYRGYQYLLEPGDFRHWNEWGAFQPQMQSLRRLRDKQWHLEGSFPVLATEPPK |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | CRYBB1 crystallin, beta B1 [ Homo sapiens ] |
Official Symbol | CRYBB1 |
Synonyms | CRYBB1; crystallin, beta B1; beta-crystallin B1; beta-B1 crystallin; eye lens structural protein; CATCN3; |
Gene ID | 1414 |
mRNA Refseq | NM_001887 |
Protein Refseq | NP_001878 |
UniProt ID | P53674 |
◆ Recombinant Proteins | ||
CRYBB1-1997M | Recombinant Mouse CRYBB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Crybb1-1445M | Recombinant Mouse Crybb1 protein, His & GST-tagged | +Inquiry |
CRYBB1-3938M | Recombinant Mouse CRYBB1 Protein | +Inquiry |
Crybb1-2329M | Recombinant Mouse Crybb1 Protein, Myc/DDK-tagged | +Inquiry |
CRYBB1-1933H | Recombinant Human CRYBB1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRYBB1-7262HCL | Recombinant Human CRYBB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRYBB1 Products
Required fields are marked with *
My Review for All CRYBB1 Products
Required fields are marked with *