Recombinant Human CSN3, His-tagged

Cat.No. : CSN3-123H
Product Overview : Recombinant Human κ-Casein/CSN3 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Glu21-Ala182) of Human CSN3 fused with a 6His tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 21-182 a.a.
Description : Kappa-Casein (CSN3) is a secreted protein that belongs to the Kappa-Casein family. CSN3 exists in heteromultimers that are composed of alpha-s 1casein and kappa casein linked by disulfide bonds. CSN3 is involved in a number of important physiological processes. In the gut, CSN3 protein is split into an insoluble peptide (para kappa-casein) and a soluble hydrophilic glycopeptide (caseinomacropeptide). Caseinomacropeptide is responsible for increased efficiency of digestion, prevention of neonate hypersensitivity to ingested proteins, and inhibition of gastric pathogens. Kappa-casein also stabilizes micelle formation, preventing casein precipitation in milk.
AA Sequence : EVQNQKQPACHENDERPFYQKTAPYVPMYYVPNSYPYYGTNLYQRRPAIAINNPCVPRTYYANPA VVRPHAQIPQRQYLPNSHPPTVVRRPNLHPSFIAIPPKKIQDKIIIPTINTIATVEPTPAPATEP TVDSVVTPEAFSESIITSTPETTTVAVTPPTAVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Gene Name CSN3 casein kappa [ Homo sapiens ]
Official Symbol CSN3
Synonyms CSN3; casein kappa; casein, kappa , CSN10; kappa-casein; KCA; CSNK; CSN10;
Gene ID 1448
mRNA Refseq NM_005212
Protein Refseq NP_005203
MIM 601695
UniProt ID P07498
Chromosome Location 4q21.1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CSN3 Products

Required fields are marked with *

My Review for All CSN3 Products

Required fields are marked with *

0
cart-icon
0
compare icon