Recombinant Human CSN3, His-tagged
Cat.No. : | CSN3-123H |
Product Overview : | Recombinant Human κ-Casein/CSN3 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Glu21-Ala182) of Human CSN3 fused with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 21-182 a.a. |
Description : | Kappa-Casein (CSN3) is a secreted protein that belongs to the Kappa-Casein family. CSN3 exists in heteromultimers that are composed of alpha-s 1casein and kappa casein linked by disulfide bonds. CSN3 is involved in a number of important physiological processes. In the gut, CSN3 protein is split into an insoluble peptide (para kappa-casein) and a soluble hydrophilic glycopeptide (caseinomacropeptide). Caseinomacropeptide is responsible for increased efficiency of digestion, prevention of neonate hypersensitivity to ingested proteins, and inhibition of gastric pathogens. Kappa-casein also stabilizes micelle formation, preventing casein precipitation in milk. |
AA Sequence : | EVQNQKQPACHENDERPFYQKTAPYVPMYYVPNSYPYYGTNLYQRRPAIAINNPCVPRTYYANPA VVRPHAQIPQRQYLPNSHPPTVVRRPNLHPSFIAIPPKKIQDKIIIPTINTIATVEPTPAPATEP TVDSVVTPEAFSESIITSTPETTTVAVTPPTAVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Gene Name | CSN3 casein kappa [ Homo sapiens ] |
Official Symbol | CSN3 |
Synonyms | CSN3; casein kappa; casein, kappa , CSN10; kappa-casein; KCA; CSNK; CSN10; |
Gene ID | 1448 |
mRNA Refseq | NM_005212 |
Protein Refseq | NP_005203 |
MIM | 601695 |
UniProt ID | P07498 |
Chromosome Location | 4q21.1 |
◆ Recombinant Proteins | ||
CSN3-1631R | Recombinant Rat CSN3 Protein | +Inquiry |
CSN3-2020M | Recombinant Mouse CSN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CSN3-2188HF | Recombinant Full Length Human CSN3 Protein, GST-tagged | +Inquiry |
CSN3-3680H | Recombinant Human CSN3 protein, His-tagged | +Inquiry |
CSN3-1836H | Recombinant Human CSN3 Protein (Asn24-Ala182), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSN3-412HCL | Recombinant Human CSN3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSN3 Products
Required fields are marked with *
My Review for All CSN3 Products
Required fields are marked with *