Recombinant Human CYSTM1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CYSTM1-2692H
Product Overview : C5orf32 MS Standard C13 and N15-labeled recombinant protein (NP_115788) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : CYSTM1 (Cysteine Rich Transmembrane Module Containing 1) is a Protein Coding gene. Diseases associated with CYSTM1 include Sengers Syndrome. Among its related pathways are Innate Immune System.
Molecular Mass : 10.6 kDa
AA Sequence : MNQENPPPYPGPGPTAPYPPYPPQPMGPGPMGGPYPPPQGYPYQGYPQYGWQGGPQEPPKTTVYVVEDQRRDELGPSTCLTACWTALCCSCLWDMLTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CYSTM1 cysteine rich transmembrane module containing 1 [ Homo sapiens (human) ]
Official Symbol CYSTM1
Synonyms CYSTM1; cysteine rich transmembrane module containing 1; C5orf32; ORF1-FL49; cysteine-rich and transmembrane domain-containing protein 1; UPF0467 protein C5orf32; putative nuclear protein ORF1-FL49
Gene ID 84418
mRNA Refseq NM_032412
Protein Refseq NP_115788
UniProt ID Q9H1C7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CYSTM1 Products

Required fields are marked with *

My Review for All CYSTM1 Products

Required fields are marked with *

0
cart-icon