Recombinant Human CYSTM1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CYSTM1-2692H |
Product Overview : | C5orf32 MS Standard C13 and N15-labeled recombinant protein (NP_115788) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | CYSTM1 (Cysteine Rich Transmembrane Module Containing 1) is a Protein Coding gene. Diseases associated with CYSTM1 include Sengers Syndrome. Among its related pathways are Innate Immune System. |
Molecular Mass : | 10.6 kDa |
AA Sequence : | MNQENPPPYPGPGPTAPYPPYPPQPMGPGPMGGPYPPPQGYPYQGYPQYGWQGGPQEPPKTTVYVVEDQRRDELGPSTCLTACWTALCCSCLWDMLTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CYSTM1 cysteine rich transmembrane module containing 1 [ Homo sapiens (human) ] |
Official Symbol | CYSTM1 |
Synonyms | CYSTM1; cysteine rich transmembrane module containing 1; C5orf32; ORF1-FL49; cysteine-rich and transmembrane domain-containing protein 1; UPF0467 protein C5orf32; putative nuclear protein ORF1-FL49 |
Gene ID | 84418 |
mRNA Refseq | NM_032412 |
Protein Refseq | NP_115788 |
UniProt ID | Q9H1C7 |
◆ Cell & Tissue Lysates | ||
CYSTM1-8015HCL | Recombinant Human C5orf32 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYSTM1 Products
Required fields are marked with *
My Review for All CYSTM1 Products
Required fields are marked with *