Recombinant Human Cytochrome P450 17A1
Cat.No. : | CYP17A1-01H |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Form : | 50mM Tris- HCl, pH7.4, 200mM NaCl, 10% glycerol |
Molecular Mass : | Theoretical MW: ~55kDa |
AA Sequence : | AKKTGAKYPKSLLSLPLVGSLPFLPRHGHMHNNFFKLQKKYGPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFS GRPQMATLDIASNNRKGIAFADSGAHWQLHRRLAMATFALFKDGDQKLEKIICQEISTLCDMLATHNGQSIDISF PVFVAVTNVISLICFNTSYKNGDPELNVIQNYNEGIIDNLSKDSLVDLVPWLKIFPNKTLEKLKSHVKIRNDLLN KILENYKEKFRSDSITNMLDTLMQAKMNSDNGNAGPDQDSELLSDNHILTTIGDIFGAGVETTTSVVKWTLAFLL HNPQVKKKLYEEIDQNVGFSRTPTISDRNRLLLLEATIREVLRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVII NLWALHHNEKEWHQPDQFMPERFLNPAGTQLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPD DGQLPSLEGIPKVVFLIDSFKVKIKVRQAWREAQAEGST |
Purity : | >90% determined by SDS-PAGE. |
Storage : | Short Term Storage +4°C. Long Term Storage -20°C please prepare aliquots and store at -20°C. Avoid freeze/thaw cycles. |
Gene Name | CYP17A1 cytochrome P450, family 17, subfamily A, polypeptide 1 [ Homo sapiens ] |
Official Symbol | CYP17A1 |
Synonyms | CYP17A1; cytochrome P450, family 17, subfamily A, polypeptide 1; CYP17, cytochrome P450, subfamily XVII (steroid 17 alpha hydroxylase), adrenal hyperplasia; steroid 17-alpha-hydroxylase/17,20 lyase; CPT7; P450C17; S17AH; Steroid 17 alpha monooxygenase; CYPXVII; cytochrome P450c17; cytochrome P450-C17; cytochrome P450 17A1; cytochrome p450 XVIIA1; steroid 17-alpha-monooxygenase; cytochrome P450, subfamily XVII (steroid 17-alpha-hydroxylase), adrenal hyperplasia; CYP17; |
Gene ID | 1586 |
mRNA Refseq | NM_000102 |
Protein Refseq | NP_000093 |
MIM | 609300 |
UniProt ID | P05093 |
Chromosome Location | 10q24.3 |
Pathway | Androgen biosynthesis, organism-specific biosystem; Biological oxidations, organism-specific biosystem; C19/C18-Steroid hormone biosynthesis, pregnenolone =>androstenedione => estrone, organism-specific biosystem; C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => |
Function | electron carrier activity; heme binding; metal ion binding; monooxygenase activity; oxygen binding; steroid 17-alpha-monooxygenase activity; |
◆ Recombinant Proteins | ||
CYP17A1-4348H | Recombinant Human CYP17A1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CYP17A1-2241H | Recombinant Human CYP17A1 Protein, GST-tagged | +Inquiry |
CYP17A1-960R | Recombinant Rhesus Macaque CYP17A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CYP17A1-795HFL | Recombinant Full Length Human CYP17A1 Protein, C-Flag-tagged | +Inquiry |
CYP17A1-1373R | Recombinant Rat CYP17A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYP17A1-7128HCL | Recombinant Human CYP17A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYP17A1 Products
Required fields are marked with *
My Review for All CYP17A1 Products
Required fields are marked with *