Recombinant Human DHRS9 Protein, GST-tagged

Cat.No. : DHRS9-2603H
Product Overview : Human DHRS9 full-length ORF ( AAH58883, 1 a.a. - 319 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. This protein demonstrates oxidoreductase activity toward hydroxysteroids and is able to convert 3-alpha-tetrahydroprogesterone to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone in the cytoplasm, and may additionally function as a transcriptional repressor in the nucleus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]
Molecular Mass : 60.83 kDa
AA Sequence : MLFWVLGLLILCGFLWTRKGKLKIEDITDKYIFITGCDSGFGNLAARTFDKKGFHVIAACLTESGSTALKAETSERLRTVLLDVTDPENVKRTAQWVKNQVGEKGLWGLINNAGVPGVLAPTDWLTLEDYREPIEVNLFGLISVTLNMLPLVKKAQGRVINVSSVGGRLAIVGGGYTPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLFKTNLADPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPVVECMDHALTSLFPKTHYAAGKDAKIFWIPLSHMPAALQDFLLLKQKAELANPKAV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DHRS9 dehydrogenase/reductase (SDR family) member 9 [ Homo sapiens ]
Official Symbol DHRS9
Synonyms DHRS9; dehydrogenase/reductase (SDR family) member 9; dehydrogenase/reductase SDR family member 9; 3 alpha hydroxysteroid dehydrogenase; 3alpha HSD; NADP dependent retinol dehydrogenase/reductase; RDH15; RDHL; retinol dehydrogenase homolog; RETSDR8; SDR9C4; short chain dehydrogenase/reductase family 9C; member 4; RDH-E2; 3-alpha-HSD; 3-alpha hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase retSDR8; NADP-dependent retinol dehydrogenase/reductase; short chain dehydrogenase/reductase family 9C, member 4; RDHTBE; 3ALPHA-HSD;
Gene ID 10170
mRNA Refseq NM_001142270
Protein Refseq NP_001135742
MIM 612131
UniProt ID Q9BPW9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DHRS9 Products

Required fields are marked with *

My Review for All DHRS9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon