Recombinant Human DHRS9 Protein, GST-tagged
Cat.No. : | DHRS9-2603H |
Product Overview : | Human DHRS9 full-length ORF ( AAH58883, 1 a.a. - 319 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. This protein demonstrates oxidoreductase activity toward hydroxysteroids and is able to convert 3-alpha-tetrahydroprogesterone to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone in the cytoplasm, and may additionally function as a transcriptional repressor in the nucleus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014] |
Molecular Mass : | 60.83 kDa |
AA Sequence : | MLFWVLGLLILCGFLWTRKGKLKIEDITDKYIFITGCDSGFGNLAARTFDKKGFHVIAACLTESGSTALKAETSERLRTVLLDVTDPENVKRTAQWVKNQVGEKGLWGLINNAGVPGVLAPTDWLTLEDYREPIEVNLFGLISVTLNMLPLVKKAQGRVINVSSVGGRLAIVGGGYTPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLFKTNLADPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPVVECMDHALTSLFPKTHYAAGKDAKIFWIPLSHMPAALQDFLLLKQKAELANPKAV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DHRS9 dehydrogenase/reductase (SDR family) member 9 [ Homo sapiens ] |
Official Symbol | DHRS9 |
Synonyms | DHRS9; dehydrogenase/reductase (SDR family) member 9; dehydrogenase/reductase SDR family member 9; 3 alpha hydroxysteroid dehydrogenase; 3alpha HSD; NADP dependent retinol dehydrogenase/reductase; RDH15; RDHL; retinol dehydrogenase homolog; RETSDR8; SDR9C4; short chain dehydrogenase/reductase family 9C; member 4; RDH-E2; 3-alpha-HSD; 3-alpha hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase retSDR8; NADP-dependent retinol dehydrogenase/reductase; short chain dehydrogenase/reductase family 9C, member 4; RDHTBE; 3ALPHA-HSD; |
Gene ID | 10170 |
mRNA Refseq | NM_001142270 |
Protein Refseq | NP_001135742 |
MIM | 612131 |
UniProt ID | Q9BPW9 |
◆ Recombinant Proteins | ||
DHRS9-1997H | Recombinant Human DHRS9 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DHRS9-1521R | Recombinant Rat DHRS9 Protein, His (Fc)-Avi-tagged | +Inquiry |
Dhrs9-2552M | Recombinant Mouse Dhrs9 Protein, Myc/DDK-tagged | +Inquiry |
DHRS9-1561H | Recombinant Human Dehydrogenase/Reductase (SDR Family) Member 9, His-tagged | +Inquiry |
DHRS9-2603H | Recombinant Human DHRS9 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DHRS9-6934HCL | Recombinant Human DHRS9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DHRS9 Products
Required fields are marked with *
My Review for All DHRS9 Products
Required fields are marked with *
0
Inquiry Basket