Recombinant Human EIF1B Protein, GST-tagged
Cat.No. : | EIF1B-4786H |
Product Overview : | Human GC20 full-length ORF ( NP_005866.1, 1 a.a. - 113 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | EIF1B (Eukaryotic Translation Initiation Factor 1B) is a Protein Coding gene. Diseases associated with EIF1B include Acquired Thrombocytopenia. Among its related pathways are RNA transport. GO annotations related to this gene include poly(A) RNA binding and translation initiation factor activity. An important paralog of this gene is EIF1. |
Molecular Mass : | 39.2 kDa |
AA Sequence : | MSTIQNLQSFDPFADATKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EIF1B eukaryotic translation initiation factor 1B [ Homo sapiens ] |
Official Symbol | EIF1B |
Synonyms | EIF1B; eukaryotic translation initiation factor 1B; eukaryotic translation initiation factor 1b; GC20; translation factor sui1 homolog; protein translation factor SUI1 homolog GC20; |
Gene ID | 10289 |
mRNA Refseq | NM_005875 |
Protein Refseq | NP_005866 |
UniProt ID | O60739 |
◆ Recombinant Proteins | ||
RFL4156MF | Recombinant Full Length Mouse G-Protein Coupled Receptor 15(Gpr15) Protein, His-Tagged | +Inquiry |
EIF1B-3480H | Recombinant Human EIF1B, His-tagged | +Inquiry |
EIF1B-5073M | Recombinant Mouse EIF1B Protein | +Inquiry |
EIF1B-9991Z | Recombinant Zebrafish EIF1B | +Inquiry |
EIF1B-1677H | Recombinant Human EIF1B Protein (Met1-Phe113), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF1B-244HCL | Recombinant Human EIF1B lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPR15 Products
Required fields are marked with *
My Review for All GPR15 Products
Required fields are marked with *
0
Inquiry Basket