Recombinant Human F12 protein, His-tagged
Cat.No. : | F12-12617H |
Product Overview : | Recombinant Human F12 protein(316-615 aa), fused with His tag, was expressed in E.coli. |
Availability | September 16, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 316-615 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MPAQPAPPKPQPTTRTPPQSQTPGALPAKREQPPSLTRNGPLSCGQRLRKSLSSMTRVVGGLVALRGAHPYIAALYWGHSFCAGSLIAPCWVLTAAHCLQDRPAPEDLTVVLGQERRNHSCEPCQTLAVRSYRLHEAFSPVSYQHDLALLRLQEDADGSCALLSPYVQPVCLPSGAARPSETTLCQVAGWGHQFEGAEEYASFLQEAQVPFLSLERCSAPDVHGSSILPGMLCAGFLEGGTDACQGDSGGPLVCEDQAAERRLTLQGIISWGSGCGDRNKPGVYTDVAYYLAWIREHTVS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | F12 coagulation factor XII (Hageman factor) [ Homo sapiens ] |
Official Symbol | F12 |
Synonyms | F12; coagulation factor XII (Hageman factor); coagulation factor XII; Hageman factor; beta-factor XIIa part 1; beta-factor XIIa part 2; coagulation factor XIIa heavy chain; coagulation factor XIIa light chain; HAF; HAE3; HAEX; |
Gene ID | 2161 |
mRNA Refseq | NM_000505 |
Protein Refseq | NP_000496 |
MIM | 610619 |
UniProt ID | P00748 |
◆ Recombinant Proteins | ||
F12-3287R | Recombinant Rat F12 protein, His-tagged | +Inquiry |
F12-1833R | Recombinant Rat F12 Protein, His (Fc)-Avi-tagged | +Inquiry |
F12-3290R | Recombinant Rat F12 protein, His-SUMO-tagged | +Inquiry |
F12-909M | Recombinant Mouse F12 Protein, His-tagged | +Inquiry |
F12-3291R | Recombinant Rat F12 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
F12-13H | Native Human Factor beta-XIIa, Biotin Labeled | +Inquiry |
F12-5397H | Active Native Human Coagulation Factor XII (Hageman factor) | +Inquiry |
F12-28805TH | Native Human F12 | +Inquiry |
◆ Cell & Tissue Lysates | ||
F12-2115HCL | Recombinant Human F12 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All F12 Products
Required fields are marked with *
My Review for All F12 Products
Required fields are marked with *