| Species : |
Pig |
| Source : |
Yeast |
| Tag : |
His |
| Protein Length : |
20-371 aa |
| Description : |
Factor XII is a serum glycoprotein that participates in the initiation of blood coagulation, fibrinolysis, and the generation of bradykinin and angiotensin. Prekallikrein is cleaved by factor XII to form kallikrein, which then cleaves factor XII first to alpha-factor XIIa and then trypsin cleaves it to beta-factor XIIa. Alpha-factor XIIa activates factor XI to factor XIa (By similarity). |
| Form : |
Tris-based buffer,50% glycerol |
| Molecular Mass : |
41.8 kDa |
| AA Sequence : |
IPPWKDPRKHKVMASEHTVVLTVTGEPCHFPFQYYRQLYYKCIQRGQRGPRPWCATTPNFEKDQRWAYCLEPMKVKDHCNKGNPCQKGGTCVNMPNGPHCICPDHFTGKHCQKEKCFEPQFLQFFQENEIWHRFEPAGVSKCQCKGPKAQCKPVASQVCSTNPCLNGGSCLQTEGHRLCRCPTGYAGRLCDVDLKERCYSDRGLSYRGMAQTTLSGAPCQPWASEATYWNMTAEQALNWGLGDHAFCRNPDNDTRPWCFVWRGDQLSWQYCRLARCQAPIGEAPPILTPTQSPSEHQDSPLLSREPQPTTQTPSQNLTSAWCAPPEQRGPLPSAGLVGCGQRLRKRLSSLNR |
| Purity : |
> 90% as determined by SDS-PAGE. |
| Notes : |
Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : |
A hardcopy of COA with reconstitution instruction is sent along with the products. |