Recombinant Human FABP3 Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : FABP3-039H
Product Overview : FABP3 MS Standard C13 and N15-labeled recombinant protein (NP_004093) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The intracellular fatty acid-binding proteins (FABPs) belongs to a multigene family. FABPs are divided into at least three distinct types, namely the hepatic-, intestinal- and cardiac-type. They form 14-15 kDa proteins and are thought to participate in the uptake, intracellular metabolism and/or transport of long-chain fatty acids. They may also be responsible in the modulation of cell growth and proliferation. Fatty acid-binding protein 3 gene contains four exons and its function is to arrest growth of mammary epithelial cells. This gene is a candidate tumor suppressor gene for human breast cancer. Alternative splicing results in multiple transcript variants.
Molecular Mass : 14.9 kDa
AA Sequence : MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEATRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name FABP3 fatty acid binding protein 3 [ Homo sapiens (human) ]
Official Symbol FABP3
Synonyms FABP3; fatty acid binding protein 3; FABP11; H-FABP; M-FABP; MDGI; O-FABP; fatty acid-binding protein, heart; epididymis secretory sperm binding protein; fatty acid binding protein 11; fatty acid binding protein 3, muscle and heart; heart-type fatty acid-binding protein; mammary-derived growth inhibitor; muscle fatty acid-binding protein
Gene ID 2170
mRNA Refseq NM_004102
Protein Refseq NP_004093
MIM 134651
UniProt ID P05413

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FABP3 Products

Required fields are marked with *

My Review for All FABP3 Products

Required fields are marked with *

0
cart-icon
0
compare icon