Recombinant Human FOXK2
Cat.No. : | FOXK2-29031TH |
Product Overview : | Recombinant fragment of Human ILF1 with N terminal proprietary tag, predicted MWt 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | The protein encoded by this gene contains a fork head DNA binding domain. This protein can bind to the purine-rich motifs of the HIV long terminal repeat (LTR), and to the similar purine-rich motif in the interleukin 2 (IL2) promoter. It may be involved in the regulation of viral and cellular promoter elements. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Expressed in both lymphoid and non-lymphoid cells. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QQAPLGQHQLPIKTVTQNGTHVASVPTAVHGQVNNAAASPLHMLATHASASASLPTKRHNGDQPEQPELKRIKTEDGEGIVIALSVDTPPAAVREKGVQN |
Sequence Similarities : | Contains 1 FHA domain.Contains 1 fork-head DNA-binding domain. |
Gene Name | FOXK2 forkhead box K2 [ Homo sapiens ] |
Official Symbol | FOXK2 |
Synonyms | FOXK2; forkhead box K2; ILF, ILF1, interleukin enhancer binding factor 1; forkhead box protein K2; |
Gene ID | 3607 |
mRNA Refseq | NM_004514 |
Protein Refseq | NP_004505 |
MIM | 147685 |
Uniprot ID | Q01167 |
Chromosome Location | 17q25 |
Function | DNA bending activity; double-stranded DNA binding; magnesium ion binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
FOXK2-3329M | Recombinant Mouse FOXK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
FOXK2-7655H | Recombinant Human FOXK2 protein, GST-tagged | +Inquiry |
FOXK2-5998M | Recombinant Mouse FOXK2 Protein | +Inquiry |
FOXK2-11H | Recombinant Human FOXK2 protein, His-tagged | +Inquiry |
FOXK2-7825Z | Recombinant Zebrafish FOXK2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FOXK2 Products
Required fields are marked with *
My Review for All FOXK2 Products
Required fields are marked with *
0
Inquiry Basket