Recombinant Human FOXK2

Cat.No. : FOXK2-29031TH
Product Overview : Recombinant fragment of Human ILF1 with N terminal proprietary tag, predicted MWt 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : The protein encoded by this gene contains a fork head DNA binding domain. This protein can bind to the purine-rich motifs of the HIV long terminal repeat (LTR), and to the similar purine-rich motif in the interleukin 2 (IL2) promoter. It may be involved in the regulation of viral and cellular promoter elements.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Expressed in both lymphoid and non-lymphoid cells.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QQAPLGQHQLPIKTVTQNGTHVASVPTAVHGQVNNAAASPLHMLATHASASASLPTKRHNGDQPEQPELKRIKTEDGEGIVIALSVDTPPAAVREKGVQN
Sequence Similarities : Contains 1 FHA domain.Contains 1 fork-head DNA-binding domain.
Gene Name FOXK2 forkhead box K2 [ Homo sapiens ]
Official Symbol FOXK2
Synonyms FOXK2; forkhead box K2; ILF, ILF1, interleukin enhancer binding factor 1; forkhead box protein K2;
Gene ID 3607
mRNA Refseq NM_004514
Protein Refseq NP_004505
MIM 147685
Uniprot ID Q01167
Chromosome Location 17q25
Function DNA bending activity; double-stranded DNA binding; magnesium ion binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FOXK2 Products

Required fields are marked with *

My Review for All FOXK2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon