Recombinant Human GADD45B Protein, MYC/DDK-tagged, C13 and N15-labeled
| Cat.No. : | GADD45B-292H |
| Product Overview : | GADD45B MS Standard C13 and N15-labeled recombinant protein (NP_056490) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The genes in this group respond to environmental stresses by mediating activation of the p38/JNK pathway. This activation is mediated via their proteins binding and activating MTK1/MEKK4 kinase, which is an upstream activator of both p38 and JNK MAPKs. The function of these genes or their protein products is involved in the regulation of growth and apoptosis. These genes are regulated by different mechanisms, but they are often coordinately expressed and can function cooperatively in inhibiting cell growth. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 17.6 kDa |
| AA Sequence : | MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGNARLAQLLGEPAETQGTTEARDLHCLPFLQNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQERTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | GADD45B growth arrest and DNA-damage-inducible, beta [ Homo sapiens (human) ] |
| Official Symbol | GADD45B |
| Synonyms | GADD45B; growth arrest and DNA-damage-inducible, beta; MYD118; growth arrest and DNA damage-inducible protein GADD45 beta; DKFZP566B133; GADD45BETA; growth arrest and DNA damage inducible beta; myeloid differentiation primary response; negative growth regulatory protein MyD118; myeloid differentiation primary response protein MyD118; DKFZp566B133; |
| Gene ID | 4616 |
| mRNA Refseq | NM_015675 |
| Protein Refseq | NP_056490 |
| MIM | 604948 |
| UniProt ID | O75293 |
| ◆ Recombinant Proteins | ||
| GADD45B-52H | Recombinant Human GADD45B protein, His-tagged | +Inquiry |
| Gadd45b-3131M | Recombinant Mouse Gadd45b Protein, Myc/DDK-tagged | +Inquiry |
| GADD45B-3458C | Recombinant Chicken GADD45B | +Inquiry |
| GADD45B-3440M | Recombinant Mouse GADD45B Protein, His (Fc)-Avi-tagged | +Inquiry |
| GADD45B-3525H | Recombinant Human GADD45B Protein (Met1-Arg160), N-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GADD45B-6054HCL | Recombinant Human GADD45B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GADD45B Products
Required fields are marked with *
My Review for All GADD45B Products
Required fields are marked with *
