Recombinant Human GADD45G protein, His-SUMO-tagged

• Cat.No.: GADD45G-2937H
• Product Overview: Recombinant Human GADD45G protein(O95257)(1-159aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-159aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 33.1 kDa
• AA Sequence: MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: GADD45G growth arrest and DNA-damage-inducible, gamma [ Homo sapiens ]
• Official Symbol: GADD45G
• Synonyms: GADD45G; growth arrest and DNA-damage-inducible, gamma; growth arrest and DNA damage-inducible protein GADD45 gamma; CR6; DDIT2; gadd related protein; 17 kD; GADD45gamma; growth arrest and DNA damage inducible gamma; GRP17; DDIT-2; GADD45-gamma; gadd-related protein, 17 kD; cytokine-responsive protein CR6; DNA damage-inducible transcript 2 protein
• Gene ID: 10912
• mRNA Refseq: NM_006705
• Protein Refseq: NP_006696
• MIM: 604949
• UniProt ID: O95257