Recombinant Human GALNT13 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | GALNT13-6166H |
Product Overview : | GALNT13 MS Standard C13 and N15-labeled recombinant protein (NP_443149) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The GALNT13 protein is a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAcT; EC 2.4.1.41) family, which initiate O-linked glycosylation of mucins by the initial transfer of N-acetylgalactosamine (GalNAc) with an alpha-linkage to a serine or threonine residue. |
Molecular Mass : | 64.1 kDa |
AA Sequence : | MRRFVYCKVVLATSLMWVLVDVFLLLYFSECNKCDDKKERSLLPALRAVISRNQEGPGEMGKAVLIPKDDQEKMKELFKINQFNLMASDLIALNRSLPDVRLEGCKTKVYPDELPNTSVVIVFHNEAWSTLLRTVYSVINRSPHYLLSEVILVDDASERDFLKLTLENYVKNLEVPVKIIRMEERSGLIRARLRGAAASKGQVITFLDAHCECTLGWLEPLLARIKEDRKTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRNYFEEIGTYDAGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYTFPGGTGHVINKNNRRLAEVWMDEFKDFFYIISPGVVKVDYGDVSVRKTLRENLKCKPFSWYLENIYPDSQIPRRYYSLGEIRNVETNQCLDNMGRKENEKVGIFNCHGMGGNQVFSYTADKEIRTDDLCLDVSRLNGPVIMLKCHHMRGNQLWEYDAERLTLRHVNSNQCLDEPSEEDKMVPTMQDCSGSRSQQWLLRNMTLGTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | GALNT13 polypeptide N-acetylgalactosaminyltransferase 13 [ Homo sapiens (human) ] |
Official Symbol | GALNT13 |
Synonyms | GALNT13; UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 13 (GalNAc-T13); polypeptide N-acetylgalactosaminyltransferase 13; GalNAc T13; KIAA1918; UDP N acetyl alpha D galactosamine:polypeptide N acetylgalactosaminyltransferase 13; pp-GaNTase 13; GalNAc transferase 13; polypeptide GalNAc transferase 13; protein-UDP acetylgalactosaminyltransferase 13; UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 13; GalNAc-T13; FLJ16031; FLJ41157; H_NH0187G20.1; MGC119459; MGC119461; WUGSC:H_NH0187G20.1; |
Gene ID | 114805 |
mRNA Refseq | NM_052917 |
Protein Refseq | NP_443149 |
MIM | 608369 |
UniProt ID | Q8IUC8 |
◆ Recombinant Proteins | ||
GALNT13-622H | Active Recombinant Human GALNT13 protein, His-tagged | +Inquiry |
GALNT13-2123R | Recombinant Rat GALNT13 Protein, His (Fc)-Avi-tagged | +Inquiry |
GALNT13-623H | Recombinant Human GALNT13 protein, MYC/DDK-tagged | +Inquiry |
GALNT13-4693H | Recombinant Human GALNT13 Protein, GST-tagged | +Inquiry |
GALNT13-5197HF | Recombinant Full Length Human GALNT13 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GALNT13-6038HCL | Recombinant Human GALNT13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GALNT13 Products
Required fields are marked with *
My Review for All GALNT13 Products
Required fields are marked with *