Recombinant Human GJA1 protein, His-tagged
Cat.No. : | GJA1-2962H |
Product Overview : | Recombinant Human GJA1 protein(P17302)(233-382aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 233-382aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 20.3 kDa |
AA Sequence : | FKGVKDRVKGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | GJA1 gap junction protein, alpha 1, 43kDa [ Homo sapiens ] |
Official Symbol | GJA1 |
Synonyms | GJA1; gap junction protein, alpha 1, 43kDa; gap junction protein, alpha 1, 43kDa (connexin 43) , gap junction protein, alpha like , GJAL, ODDD; gap junction alpha-1 protein; connexin 43; CX43; oculodentodigital dysplasia (syndactyly type III); ODD; ODOD; SDTY3; connexin-43; gap junction 43 kDa heart protein; HSS; GJAL; ODDD; AVSD3; HLHS1; DFNB38; |
Gene ID | 2697 |
mRNA Refseq | NM_000165 |
Protein Refseq | NP_000156 |
MIM | 121014 |
UniProt ID | P17302 |
◆ Recombinant Proteins | ||
GJA1-6368M | Recombinant Mouse GJA1 Protein | +Inquiry |
RFL25501BF | Recombinant Full Length Bovine Gap Junction Alpha-1 Protein(Gja1) Protein, His-Tagged | +Inquiry |
GJA1-2221H | Recombinant Human GJA1 protein, His-tagged | +Inquiry |
GJA1-1857R | Recombinant Rhesus monkey GJA1 Protein, His-tagged | +Inquiry |
Gja1-951M | Recombinant Mouse Gja1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GJA1-5923HCL | Recombinant Human GJA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GJA1 Products
Required fields are marked with *
My Review for All GJA1 Products
Required fields are marked with *
0
Inquiry Basket