Recombinant Human GNRH1 Protein, GST-tagged

Cat.No. : GNRH1-5096H
Product Overview : Human GNRH1 full-length ORF ( NP_000816.1, 1 a.a. - 92 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a preproprotein that is proteolytically processed to generate a peptide that is a member of the gonadotropin-releasing hormone (GnRH) family of peptides. Alternative splicing results in multiple transcript variants, at least one of which is secreted and then cleaved to generate gonadoliberin-1 and GnRH-associated peptide 1. Gonadoliberin-1 stimulates the release of luteinizing and follicle stimulating hormones, which are important for reproduction. Mutations in this gene are associated with hypogonadotropic hypogonadism. [provided by RefSeq, Nov 2015]
Molecular Mass : 35.75 kDa
AA Sequence : MKPIQKLLAGLILLTWCVEGCSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GNRH1 gonadotropin-releasing hormone 1 (luteinizing-releasing hormone) [ Homo sapiens ]
Official Symbol GNRH1
Synonyms GNRH1; gonadotropin-releasing hormone 1 (luteinizing-releasing hormone); GNRH, gonadotropin releasing hormone 1 (leutinizing releasing hormone), GRH, LHRH; progonadoliberin-1; luliberin I; progonadoliberin I; GnRH-associated peptide 1; prolactin release-inhibiting factor; gonadotropin-releasing hormone 1 (leutinizing-releasing hormone); GRH; GNRH; LHRH; LNRH;
Gene ID 2796
mRNA Refseq NM_000825
Protein Refseq NP_000816
MIM 152760
UniProt ID P01148

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GNRH1 Products

Required fields are marked with *

My Review for All GNRH1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon