Recombinant Human GNRH1 Protein, GST-tagged
| Cat.No. : | GNRH1-5096H |
| Product Overview : | Human GNRH1 full-length ORF ( NP_000816.1, 1 a.a. - 92 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a preproprotein that is proteolytically processed to generate a peptide that is a member of the gonadotropin-releasing hormone (GnRH) family of peptides. Alternative splicing results in multiple transcript variants, at least one of which is secreted and then cleaved to generate gonadoliberin-1 and GnRH-associated peptide 1. Gonadoliberin-1 stimulates the release of luteinizing and follicle stimulating hormones, which are important for reproduction. Mutations in this gene are associated with hypogonadotropic hypogonadism. [provided by RefSeq, Nov 2015] |
| Molecular Mass : | 35.75 kDa |
| AA Sequence : | MKPIQKLLAGLILLTWCVEGCSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GNRH1 gonadotropin-releasing hormone 1 (luteinizing-releasing hormone) [ Homo sapiens ] |
| Official Symbol | GNRH1 |
| Synonyms | GNRH1; gonadotropin-releasing hormone 1 (luteinizing-releasing hormone); GNRH, gonadotropin releasing hormone 1 (leutinizing releasing hormone), GRH, LHRH; progonadoliberin-1; luliberin I; progonadoliberin I; GnRH-associated peptide 1; prolactin release-inhibiting factor; gonadotropin-releasing hormone 1 (leutinizing-releasing hormone); GRH; GNRH; LHRH; LNRH; |
| Gene ID | 2796 |
| mRNA Refseq | NM_000825 |
| Protein Refseq | NP_000816 |
| MIM | 152760 |
| UniProt ID | P01148 |
| ◆ Recombinant Proteins | ||
| GNRH1-2269R | Recombinant Rat GNRH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GNRH1-2614R | Recombinant Rat GNRH1 Protein | +Inquiry |
| GNRH1-7814C | Recombinant Chicken GNRH1 protein, His & S-tagged | +Inquiry |
| GNRH1-2811H | Recombinant Human GNRH1 Protein, His-tagged, OVA Conjugated | +Inquiry |
| GNRH1-219H | Recombinant Human GNRH1, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GNRH1-5839HCL | Recombinant Human GNRH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNRH1 Products
Required fields are marked with *
My Review for All GNRH1 Products
Required fields are marked with *



