Recombinant Human GOT2 protein, His&Myc-tagged
Cat.No. : | GOT2-3534H |
Product Overview : | Recombinant Human GOT2 protein(P00505)(30-430aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 30-430aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 52.2 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | SSWWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSEVLKSGRFVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKVMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLAHAIHQVTK |
Gene Name | GOT2 glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2) [ Homo sapiens ] |
Official Symbol | GOT2 |
Synonyms | GOT2; glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2); aspartate aminotransferase, mitochondrial; KAT4; KATIV; kynurenine aminotransferase IV; mitAAT; FABP-1; FABPpm; mAspAT; transaminase A; fatty acid-binding protein; glutamate oxaloacetate transaminase 2; plasma membrane-associated fatty acid-binding protein; FLJ40994; |
Gene ID | 2806 |
mRNA Refseq | NM_002080 |
Protein Refseq | NP_002071 |
MIM | 138150 |
UniProt ID | P00505 |
◆ Recombinant Proteins | ||
GOT2-3804M | Recombinant Mouse GOT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GOT2-3534H | Recombinant Human GOT2 protein, His&Myc-tagged | +Inquiry |
GOT2-2624R | Recombinant Rat GOT2 Protein | +Inquiry |
GOT2-2279R | Recombinant Rat GOT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GOT2-5128H | Recombinant Human GOT2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GOT2-302HCL | Recombinant Human GOT2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GOT2 Products
Required fields are marked with *
My Review for All GOT2 Products
Required fields are marked with *
0
Inquiry Basket