Recombinant Human GPATCH3 Protein, GST-tagged
| Cat.No. : | GPATCH3-5141H |
| Product Overview : | Human GPATCH3 full-length ORF ( AAH07767.1, 1 a.a. - 525 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | GPATCH3 (G-Patch Domain Containing 3) is a Protein Coding gene. GO annotations related to this gene include nucleic acid binding. |
| Molecular Mass : | 85.7 kDa |
| AA Sequence : | MAVPGEAEEEATVYLVVSGIPSVLRSAHLRSYFSQFREERGGGFLCFHYRHRPERAPPQAAPNSALIPTDPAAEGQLLSQTSATDVRPLSTRDSTPIQTRTCCCVISVRGLAQAQRLIRMYSGRRWLDSHGTWLPGRCLIRRLRLPTEASGLGSFPFKTRKELQSWKAENEAFTLADLKQLPELNPPVLMPRGNVGTPLRVFLELIRACRLPPRIITQLQLQFPKTGSSRRYGNVPFEYEDSETVEQEELVYTAEGEEIPQGTYLADIPASPCGEPEEEVGKEEEEESHSDEDDDRGEEWERHEALHEDVTGQERTTEQLFEEEIELKWEKGGSGLVFYTDAQFWQEEEGDFDEQTADDWDVDMSVYYDRDGGDKDARDSVQMRLEQRLRDGQEDGSVIERQVGTFERHTKGIGRKVMERQGWAEGQGLGCRCSGVPEALDSDGQHPRCKRGLGYHGEKLQPFGQLKRPRRNGLGLISTIYDEPLPQDQTESLLRRQPPTSMKFRTDMAFVRGSSCASDSPSLPD |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GPATCH3 G patch domain containing 3 [ Homo sapiens ] |
| Official Symbol | GPATCH3 |
| Synonyms | GPATCH3; G patch domain containing 3; GPATC3; G patch domain-containing protein 3; FLJ12455; DKFZp686E0221; |
| Gene ID | 63906 |
| mRNA Refseq | NM_022078 |
| Protein Refseq | NP_071361 |
| MIM | 617486 |
| UniProt ID | Q96I76 |
| ◆ Recombinant Proteins | ||
| GPATCH3-5119Z | Recombinant Zebrafish GPATCH3 | +Inquiry |
| Gpatch3-3282M | Recombinant Mouse Gpatch3 Protein, Myc/DDK-tagged | +Inquiry |
| GPATCH3-4622H | Recombinant Human GPATCH3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| GPATCH3-5495HF | Recombinant Full Length Human GPATCH3 Protein, GST-tagged | +Inquiry |
| GPATCH3-4177C | Recombinant Chicken GPATCH3 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GPATCH3-5817HCL | Recombinant Human GPATCH3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPATCH3 Products
Required fields are marked with *
My Review for All GPATCH3 Products
Required fields are marked with *
