Recombinant Human GPATCH4 protein, His&Myc-tagged
Cat.No. : | GPATCH4-2564H |
Product Overview : | Recombinant Human GPATCH4 protein(Q5T3I0)(1-190aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-190a.a. |
Tag : | His&Myc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 28.6 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MNVTPEVKSRGMKFAEEQLLKHGWTQGKGLGRKENGITQALRVTLKQDTHGVGHDPAKEFTNHWWNELFNKTAANLVVETGQDGVQIRSLSKETTRYNHPKPNLLYQKFVKMATLTSGGEKPNKDLESCSDDDNQGSKSPKILTDEMLLQACEGRTAHKAARLGITMKAKLARLEAQEQAFLARLKGQDP |
Gene Name | GPATCH4 G patch domain containing 4 [ Homo sapiens ] |
Official Symbol | GPATCH4 |
Synonyms | GPATCH4; G patch domain containing 4; GPATC4; G patch domain-containing protein 4; DKFZP434F1735; FLJ20249; |
Gene ID | 54865 |
mRNA Refseq | NM_015590 |
Protein Refseq | NP_056405 |
UniProt ID | Q5T3I0 |
◆ Recombinant Proteins | ||
GPATCH4-2283R | Recombinant Rat GPATCH4 Protein, His (Fc)-Avi-tagged | +Inquiry |
GPATCH4-2564H | Recombinant Human GPATCH4 protein, His&Myc-tagged | +Inquiry |
GPATCH4-5498HF | Recombinant Full Length Human GPATCH4 Protein, GST-tagged | +Inquiry |
GPATCH4-13408H | Recombinant Human GPATCH4, His-tagged | +Inquiry |
GPATCH4-7094M | Recombinant Mouse GPATCH4 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPATCH4-732HCL | Recombinant Human GPATCH4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPATCH4 Products
Required fields are marked with *
My Review for All GPATCH4 Products
Required fields are marked with *
0
Inquiry Basket