Recombinant Human GPN2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : GPN2-5565H
Product Overview : GPN2 MS Standard C13 and N15-labeled recombinant protein (NP_060536) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : GPN2 (GPN-Loop GTPase 2) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include nucleotide binding and hydrolase activity. An important paralog of this gene is GPN3.
Molecular Mass : 34.5 kDa
AA Sequence : MAGAAPTTAFGQAVIGPPGSGKTTYCLGMSEFLRALGRRVAVVNLDPANEGLPYECAVDVGELVGLGDVMDALRLGPNGGLLYCMEYLEANLDWLRAKLDPLRGHYFLFDCPGQVELCTHHGALRSIFSQMAQWDLRLTAVHLVDSHYCTDPAKFISVLCTSLATMLHVELPHINLLSKMDLIEHYGKLAFNLDYYTEVLDLSYLLDHLASDPFFRHYRQLNEKLVRLIEDYSLVSFIPLNIQDKESIQRVLQAVDKANGYCFGAQEQRSLEAMMSAAMGADFHFSSTLGIQEKYLAPSNQSVEQEAMQLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name GPN2 GPN-loop GTPase 2 [ Homo sapiens (human) ]
Official Symbol GPN2
Synonyms GPN2; GPN-loop GTPase 2; ATP binding domain 1 family, member B, ATPBD1B; FLJ10349; ATP-binding domain 1 family member B; ATP binding domain 1 family, member B; ATPBD1B;
Gene ID 54707
mRNA Refseq NM_018066
Protein Refseq NP_060536
UniProt ID Q9H9Y4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GPN2 Products

Required fields are marked with *

My Review for All GPN2 Products

Required fields are marked with *

0
cart-icon