Recombinant Human GPR1 Protein
Cat.No. : | GPR1-5165H |
Product Overview : | Human GPR1 full-length ORF (NP_005270.2) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | GPR1 (G Protein-Coupled Receptor 1) is a Protein Coding gene. Among its related pathways are Peptide ligand-binding receptors. GO annotations related to this gene include G-protein coupled receptor activity and neuropeptide binding. An important paralog of this gene is CMKLR1. |
Form : | Liquid |
Molecular Mass : | 41.4 kDa |
AA Sequence : | MEDLEETLFEEFENYSYDLDYYSLESDLEEKVQLGVVHWVSLVLYCLAFVLGIPGNAIVIWFTGFKWKKTVTTLWFLNLAIADFIFLLFLPLYISYVAMNFHWPFGIWLCKANSFTAQLNMFASVFFLTVISLDHYIHLIHPVLSHRHRTLKNSLIVIIFIWLLASLIGGPALYFRDTVEFNNHTLCYNNFQKHDPDLTLIRHHVLTWVKFIIGYLFPLLTMSICYLCLIFKVKKRSILISSRHFWTILVVVVAFVVCWTPYHLFSIWELTIHHNSYSHHVMQAGIPLSTGLAFLNSCLNPILYVLISKKFQARFRSSVAEILKYTLWEVSCSGTVSEQLRNSETKNLCLLETAQ |
Applications : | Antibody Production Functional Study Compound Screening |
Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | GPR1 G protein-coupled receptor 1 [ Homo sapiens ] |
Official Symbol | GPR1 |
Synonyms | GPR1 G; protein-coupled receptor 1 |
Gene ID | 2825 |
mRNA Refseq | NM_005279 |
Protein Refseq | NP_005270 |
MIM | 600239 |
UniProt ID | P46091 |
◆ Cell & Tissue Lysates | ||
GPR1-736HCL | Recombinant Human GPR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPR1 Products
Required fields are marked with *
My Review for All GPR1 Products
Required fields are marked with *
0
Inquiry Basket