Recombinant Human GPR182 Protein
Cat.No. : | GPR182-5219H |
Product Overview : | Human GPR182 full-length ORF (NP_009195.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | Adrenomedullin is a potent vasodilator peptide that exerts major effects on cardiovascular function. This gene encodes a seven-transmembrane protein that belongs to the family 1 of G-protein coupled receptors. Studies of the rat counterpart suggest that the encoded protein may function as a receptor for adrenomedullin. [provided by RefSeq |
Form : | Liquid |
Molecular Mass : | 45.3 kDa |
AA Sequence : | MSVKPSWGPGPSEGVTAVPTSDLGEIHNWTELLDLFNHTLSECHVELSQSTKRVVLFALYLAMFVVGLVENLLVICVNWRGSGRAGLMNLYILNMAIADLGIVLSLPVWMLEVTLDYTWLWGSFSCRFTHYFYFVNMYSSIFFLVCLSVDRYVTLTSASPSWQRYQHRVRRAMCAGIWVLSAIIPLPEVVHIQLVEGPEPMCLFMAPFETYSTWALAVALSTTILGFLLPFPLITVFNVLTACRLRQPGQPKSRRHCLLLCAYVAVFVMCWLPYHVTLLLLTLHGTHISLHCHLVHLLYFFYDVIDCFSMLHCVINPILYNFLSPHFRGRLLNAVVHYLPKDQTKAGTCASSSSCSTQHSIIITKGDSQPAAAAPHPEPSLSFQAHHLLPNTSPISPTQPLTPS |
Applications : | Antibody Production Functional Study Compound Screening |
Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | GPR182 G protein-coupled receptor 182 [ Homo sapiens ] |
Official Symbol | GPR182 |
Synonyms | GPR182; G protein-coupled receptor 182; ADMR, adrenomedullin receptor; G-protein coupled receptor 182; AM R; G10D; hrhAMR; adrenomedullin receptor; AMR; 7TMR; ADMR; AM-R; gamrh; MGC34399; |
Gene ID | 11318 |
mRNA Refseq | NM_007264 |
Protein Refseq | NP_009195 |
MIM | 605307 |
UniProt ID | O15218 |
◆ Cell & Tissue Lysates | ||
GPR182-5791HCL | Recombinant Human GPR182 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPR182 Products
Required fields are marked with *
My Review for All GPR182 Products
Required fields are marked with *
0
Inquiry Basket