Recombinant Human GPR182 Protein

Cat.No. : GPR182-5219H
Product Overview : Human GPR182 full-length ORF (NP_009195.1) recombinant protein without tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Description : Adrenomedullin is a potent vasodilator peptide that exerts major effects on cardiovascular function. This gene encodes a seven-transmembrane protein that belongs to the family 1 of G-protein coupled receptors. Studies of the rat counterpart suggest that the encoded protein may function as a receptor for adrenomedullin. [provided by RefSeq
Form : Liquid
Molecular Mass : 45.3 kDa
AA Sequence : MSVKPSWGPGPSEGVTAVPTSDLGEIHNWTELLDLFNHTLSECHVELSQSTKRVVLFALYLAMFVVGLVENLLVICVNWRGSGRAGLMNLYILNMAIADLGIVLSLPVWMLEVTLDYTWLWGSFSCRFTHYFYFVNMYSSIFFLVCLSVDRYVTLTSASPSWQRYQHRVRRAMCAGIWVLSAIIPLPEVVHIQLVEGPEPMCLFMAPFETYSTWALAVALSTTILGFLLPFPLITVFNVLTACRLRQPGQPKSRRHCLLLCAYVAVFVMCWLPYHVTLLLLTLHGTHISLHCHLVHLLYFFYDVIDCFSMLHCVINPILYNFLSPHFRGRLLNAVVHYLPKDQTKAGTCASSSSCSTQHSIIITKGDSQPAAAAPHPEPSLSFQAHHLLPNTSPISPTQPLTPS
Applications : Antibody Production
Functional Study
Compound Screening
Usage : Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name GPR182 G protein-coupled receptor 182 [ Homo sapiens ]
Official Symbol GPR182
Synonyms GPR182; G protein-coupled receptor 182; ADMR, adrenomedullin receptor; G-protein coupled receptor 182; AM R; G10D; hrhAMR; adrenomedullin receptor; AMR; 7TMR; ADMR; AM-R; gamrh; MGC34399;
Gene ID 11318
mRNA Refseq NM_007264
Protein Refseq NP_009195
MIM 605307
UniProt ID O15218

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GPR182 Products

Required fields are marked with *

My Review for All GPR182 Products

Required fields are marked with *

0
cart-icon
0
compare icon